230520

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 354007..354585 Replicon chromosome
Accession NZ_CP090379
Organism Vibrio cholerae strain BY369

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag LVJ30_RS15570 Protein ID WP_001180243.1
Coordinates 354007..354324 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag LVJ30_RS15575 Protein ID WP_000557292.1
Coordinates 354343..354585 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LVJ30_RS15510 (LVJ30_15515) 349393..349593 + 201 WP_233195476.1 DUF6404 family protein -
LVJ30_RS15515 (LVJ30_15520) 349692..349835 + 144 Protein_336 acetyltransferase -
LVJ30_RS15520 (LVJ30_15525) 349958..350077 + 120 WP_001900954.1 DUF645 family protein -
LVJ30_RS15525 (LVJ30_15530) 350254..350649 + 396 WP_000046953.1 DUF6404 family protein -
LVJ30_RS15530 (LVJ30_15535) 350793..351329 + 537 WP_000644491.1 nucleotidyltransferase family protein -
LVJ30_RS15535 (LVJ30_15540) 351680..351742 + 63 Protein_340 DUF645 family protein -
LVJ30_RS15540 (LVJ30_15545) 351732..351842 + 111 WP_223804330.1 Tfp pilus assembly protein -
LVJ30_RS15545 (LVJ30_15550) 352001..352426 + 426 WP_000403014.1 GNAT family N-acetyltransferase -
LVJ30_RS15550 (LVJ30_15555) 352575..352922 + 348 WP_000933409.1 hypothetical protein -
LVJ30_RS15555 (LVJ30_15560) 353069..353362 + 294 WP_125460920.1 hypothetical protein -
LVJ30_RS15560 (LVJ30_15565) 353425..353600 + 176 Protein_345 acetyltransferase -
LVJ30_RS15565 (LVJ30_15570) 353661..353813 + 153 Protein_346 DUF645 family protein -
LVJ30_RS15570 (LVJ30_15575) 354007..354324 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LVJ30_RS15575 (LVJ30_15580) 354343..354585 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LVJ30_RS15580 (LVJ30_15585) 354827..355336 + 510 WP_000405987.1 GNAT family N-acetyltransferase -
LVJ30_RS15585 (LVJ30_15590) 355393..356046 + 654 WP_000226874.1 hypothetical protein -
LVJ30_RS15590 (LVJ30_15595) 356135..356344 + 210 WP_001900246.1 DUF3709 domain-containing protein -
LVJ30_RS15595 (LVJ30_15600) 356356..356574 + 219 WP_001917086.1 DUF3709 domain-containing protein -
LVJ30_RS15600 (LVJ30_15605) 356763..356956 + 194 Protein_353 hypothetical protein -
LVJ30_RS15605 (LVJ30_15610) 356977..357210 + 234 WP_032482776.1 DUF3709 domain-containing protein -
LVJ30_RS15610 (LVJ30_15615) 357635..357815 + 181 Protein_355 DUF645 family protein -
LVJ30_RS15615 (LVJ30_15620) 357928..358041 + 114 WP_001894955.1 hypothetical protein -
LVJ30_RS15620 (LVJ30_15625) 358082..358369 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
LVJ30_RS15625 (LVJ30_15630) 358380..358697 + 318 WP_001232701.1 HigA family addiction module antitoxin -
LVJ30_RS15630 (LVJ30_15635) 358694..358804 + 111 WP_134814058.1 DUF3265 domain-containing protein -
LVJ30_RS15635 (LVJ30_15640) 358843..358953 + 111 Protein_360 acetyltransferase -
LVJ30_RS15640 (LVJ30_15645) 358981..359106 + 126 WP_001944767.1 DUF645 family protein -
LVJ30_RS15645 (LVJ30_15650) 359069..359185 + 117 WP_001889170.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304645..399892 95247
inside Integron - - 309725..399516 89791


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T230520 WP_001180243.1 NZ_CP090379:c354324-354007 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

>T230520 NZ_CP124916:c2730383-2730240 [Enterococcus faecalis]
ATGAGCGTACTTCCAAAATTTACAGAAAGGAGAGGCCTGTTGTCAGCATATGAGACAATTCAGACGATCCTAGGTTTTGG
TATGTTTACCATTGCTTTGATTGCACTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT230520 WP_000557292.1 NZ_CP090379:c354585-354343 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp

>AT230520 NZ_CP124916:2730121-2730307 [Enterococcus faecalis]
TGTGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGATGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References