Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 430726..431130 | Replicon | chromosome II |
Accession | NC_016945 | ||
Organism | Vibrio cholerae IEC224 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | O3Y_RS16270 | Protein ID | WP_001114075.1 |
Coordinates | 430861..431130 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | O3Y_RS20350 | Protein ID | WP_099607150.1 |
Coordinates | 430726..430830 (+) | Length | 35 a.a. |
Genomic Context
Location: 426227..427144 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 427301..427690 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 427826..428035 (210 bp)
Type: Others
Protein ID: Protein_464
Type: Others
Protein ID: Protein_464
Location: 428154..428591 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 428655..428873 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 429048..429920 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 430070..430669 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 430726..430830 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 430861..431130 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 431124..431645 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 431944..432069 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 432320..432715 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 433607..434122 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 434306..434719 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 432854..433132 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 433129..433413 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3Y_RS16235 | 426227..427144 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
O3Y_RS16240 | 427301..427690 | + | 390 | WP_001081302.1 | hypothetical protein | - |
O3Y_RS16245 | 427826..428035 | + | 210 | Protein_464 | GNAT family N-acetyltransferase | - |
O3Y_RS16250 | 428154..428591 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
O3Y_RS16255 | 428655..428873 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
O3Y_RS16260 | 429048..429920 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
O3Y_RS16265 | 430070..430669 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
O3Y_RS20350 | 430726..430830 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
O3Y_RS16270 | 430861..431130 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
O3Y_RS16275 | 431124..431645 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
O3Y_RS20355 | 431944..432069 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
O3Y_RS16280 | 432320..432715 | + | 396 | WP_001000867.1 | hypothetical protein | - |
O3Y_RS16285 | 432854..433132 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
O3Y_RS16290 | 433129..433413 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
O3Y_RS16295 | 433607..434122 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
O3Y_RS16300 | 434306..434719 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304637..435582 | 130945 | |
inside | Integron | - | - | 309717..435206 | 125489 | ||
flank | IS/Tn | - | - | 428154..428591 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T26158 WP_001114075.1 NC_016945:430861-431130 [Vibrio cholerae IEC224]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T26158 NC_016945:430861-431130 [Vibrio cholerae IEC224]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT26158 WP_099607150.1 NC_016945:430726-430830 [Vibrio cholerae IEC224]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT26158 NC_016945:430726-430830 [Vibrio cholerae IEC224]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |