Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 481070..481598 | Replicon | chromosome |
Accession | NZ_CP013318 | ||
Organism | Vibrio cholerae strain NCTC5395 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | ASZ85_RS17075 | Protein ID | WP_000221354.1 |
Coordinates | 481311..481598 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | ASZ85_RS17070 | Protein ID | WP_001250179.1 |
Coordinates | 481070..481321 (+) | Length | 84 a.a. |
Genomic Context
Location: 476338..476652 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 476789..477223 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 477391..477546 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 478719..479025 (307 bp)
Type: Others
Protein ID: Protein_529
Type: Others
Protein ID: Protein_529
Location: 479162..479854 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 479854..480255 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 480225..480368 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 480443..480856 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 481070..481321 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 481311..481598 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 481726..482181 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 482503..482655 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 483854..484522 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 484674..484961 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 485102..485473 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 485540..485965 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 485962..486495 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 477671..478651 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 482857..483354 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 483351..483623 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ85_RS17020 | 476338..476652 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
ASZ85_RS17025 | 476789..477223 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS21305 | 477391..477546 | + | 156 | WP_000751734.1 | hypothetical protein | - |
ASZ85_RS17040 | 477671..478651 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
ASZ85_RS17045 | 478719..479025 | + | 307 | Protein_529 | CatB-related O-acetyltransferase | - |
ASZ85_RS17050 | 479162..479854 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS17055 | 479854..480255 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
ASZ85_RS21215 | 480225..480368 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
ASZ85_RS17065 | 480443..480856 | + | 414 | WP_000049417.1 | VOC family protein | - |
ASZ85_RS17070 | 481070..481321 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ASZ85_RS17075 | 481311..481598 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ85_RS17080 | 481726..482181 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS17090 | 482503..482655 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
ASZ85_RS17095 | 482857..483354 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS17100 | 483351..483623 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
ASZ85_RS17105 | 483854..484522 | + | 669 | WP_000043871.1 | hypothetical protein | - |
ASZ85_RS17110 | 484674..484961 | + | 288 | WP_000426470.1 | hypothetical protein | - |
ASZ85_RS17115 | 485102..485473 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
ASZ85_RS17120 | 485540..485965 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
ASZ85_RS17125 | 485962..486495 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 338285..496833 | 158548 | |
inside | Integron | - | - | 343365..496457 | 153092 | ||
flank | IS/Tn | - | - | 477671..478651 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T58405 WP_000221354.1 NZ_CP013318:481311-481598 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T58405 NZ_CP013318:481311-481598 [Vibrio cholerae]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT58405 WP_001250179.1 NZ_CP013318:481070-481321 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT58405 NZ_CP013318:481070-481321 [Vibrio cholerae]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |