254465

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 730492..731070 Replicon chromosome
Accession NZ_CP102928
Organism Vibrio cholerae strain N1252

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag NW313_RS17090 Protein ID WP_001180243.1
Coordinates 730492..730809 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag NW313_RS17095 Protein ID WP_000557292.1
Coordinates 730828..731070 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW313_RS17055 726016..726198 + 183 WP_000923340.1 DUF645 family protein -
NW313_RS17060 726318..726380 + 63 Protein_635 acetyltransferase -
NW313_RS17065 726552..726734 + 183 WP_000923153.1 DUF645 family protein -
NW313_RS17070 726929..727606 + 678 WP_000254617.1 HNH endonuclease signature motif containing protein -
NW313_RS17075 727768..728976 + 1209 WP_000272282.1 deoxyguanosinetriphosphate triphosphohydrolase family protein -
NW313_RS17080 729138..729842 + 705 WP_000087610.1 HNH endonuclease -
NW313_RS17085 730000..730338 + 339 WP_000713853.1 hypothetical protein -
NW313_RS17090 730492..730809 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NW313_RS17095 730828..731070 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NW313_RS17100 731314..731700 + 387 WP_001015867.1 NUDIX hydrolase -
NW313_RS17105 731757..731870 + 114 WP_001900214.1 hypothetical protein -
NW313_RS17110 731879..732100 + 222 WP_032467793.1 DUF1289 domain-containing protein -
NW313_RS17115 732358..732894 + 537 WP_000469482.1 GNAT family protein -
NW313_RS17120 733085..733546 + 462 WP_001903091.1 lipocalin family protein -
NW313_RS17125 733611..733679 + 69 Protein_648 acetyltransferase -
NW313_RS17130 733696..734193 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
NW313_RS17135 734190..734462 - 273 WP_000246253.1 DUF1778 domain-containing protein -
NW313_RS17140 734855..734980 + 126 WP_001900195.1 DUF645 family protein -
NW313_RS17145 735230..735676 + 447 WP_000006157.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 713852..820357 106505
inside Integron catB9 - 718932..819981 101049
- flank IS/Tn - - 735739..736950 1211


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T254465 WP_001180243.1 NZ_CP102928:c730809-730492 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT254465 WP_000557292.1 NZ_CP102928:c731070-730828 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References