Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 958599..959137 | Replicon | chromosome |
Accession | NZ_LT992487 | ||
Organism | Vibrio cholerae strain 4295STDY6534216 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | DG247_RS18945 | Protein ID | WP_000802136.1 |
Coordinates | 958838..959137 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | DG247_RS18940 | Protein ID | WP_001107719.1 |
Coordinates | 958599..958841 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG247_RS18885 | 954015..954155 | - | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
DG247_RS18890 | 954121..955056 | - | 936 | WP_000051985.1 | restriction endonuclease | - |
DG247_RS18895 | 955337..955936 | - | 600 | WP_000429495.1 | hypothetical protein | - |
DG247_RS18905 | 956091..956357 | - | 267 | WP_000937852.1 | hypothetical protein | - |
DG247_RS18915 | 956571..957254 | - | 684 | WP_000877436.1 | hypothetical protein | - |
DG247_RS18925 | 957678..957770 | - | 93 | WP_014164112.1 | DUF3265 domain-containing protein | - |
DG247_RS18930 | 957792..958370 | - | 579 | WP_000110120.1 | hypothetical protein | - |
DG247_RS18940 | 958599..958841 | + | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
DG247_RS18945 | 958838..959137 | + | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DG247_RS18950 | 959265..959660 | - | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
DG247_RS18955 | 959874..960053 | - | 180 | WP_001883058.1 | DUF645 family protein | - |
DG247_RS18970 | 960631..960741 | - | 111 | WP_079857360.1 | DUF3265 domain-containing protein | - |
DG247_RS18975 | 960751..961449 | - | 699 | WP_001890502.1 | hypothetical protein | - |
DG247_RS18980 | 961572..962198 | - | 627 | WP_000365424.1 | LysE family translocator | - |
DG247_RS18985 | 962240..962332 | - | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
DG247_RS18990 | 962347..962820 | - | 474 | WP_001161076.1 | GrpB family protein | - |
DG247_RS18995 | 963020..963202 | - | 183 | WP_000923182.1 | DUF645 family protein | - |
DG247_RS19840 | 963263..963391 | - | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 897525..994497 | 96972 | |
inside | Integron | catB9 | - | 897901..987709 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T294360 WP_000802136.1 NZ_LT992487:958838-959137 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|