Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 388914..389461 | Replicon | chromosome |
Accession | NZ_LT992489 | ||
Organism | Vibrio cholerae strain 4295STDY6534232 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | DG176_RS16110 | Protein ID | WP_000229317.1 |
Coordinates | 388914..389216 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | DG176_RS16115 | Protein ID | WP_000861987.1 |
Coordinates | 389204..389461 (-) | Length | 86 a.a. |
Genomic Context
Location: 392535..392807 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 392804..393301 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 384077..384181 (105 bp)
Type: Others
Protein ID: WP_099607150.1
Type: Others
Protein ID: WP_099607150.1
Location: 384238..384837 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 384987..385859 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 386034..386252 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 386316..386753 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 386872..387081 (210 bp)
Type: Others
Protein ID: Protein_329
Type: Others
Protein ID: Protein_329
Location: 387217..387606 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 387763..388680 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 388914..389216 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 389204..389461 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 389663..390196 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 390193..390618 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 390685..391056 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 391197..391484 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 391636..392304 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 393503..393655 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 393977..394432 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG176_RS16070 | 384077..384181 | - | 105 | WP_099607150.1 | acetyltransferase | - |
DG176_RS16075 | 384238..384837 | - | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
DG176_RS16080 | 384987..385859 | - | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
DG176_RS16085 | 386034..386252 | - | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
DG176_RS16090 | 386316..386753 | - | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
DG176_RS16095 | 386872..387081 | - | 210 | Protein_329 | GNAT family N-acetyltransferase | - |
DG176_RS16100 | 387217..387606 | - | 390 | WP_001081302.1 | hypothetical protein | - |
DG176_RS16105 | 387763..388680 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
DG176_RS16110 | 388914..389216 | - | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DG176_RS16115 | 389204..389461 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
DG176_RS16125 | 389663..390196 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
DG176_RS16130 | 390193..390618 | - | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
DG176_RS16135 | 390685..391056 | - | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
DG176_RS16140 | 391197..391484 | - | 288 | WP_000426470.1 | hypothetical protein | - |
DG176_RS16145 | 391636..392304 | - | 669 | WP_000043871.1 | hypothetical protein | - |
DG176_RS16150 | 392535..392807 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
DG176_RS16155 | 392804..393301 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
DG176_RS16165 | 393503..393655 | - | 153 | WP_001884520.1 | DUF645 family protein | - |
DG176_RS16170 | 393977..394432 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 379325..476297 | 96972 | |
flank | IS/Tn | - | - | 386316..386753 | 437 | ||
inside | Integron | catB9 | - | 379701..469509 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T294371 WP_000229317.1 NZ_LT992489:c389216-388914 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |