Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 326672..327212 | Replicon | chromosome |
Accession | NZ_CP009041 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain FJ147 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | IR04_RS01480 | Protein ID | WP_000277238.1 |
Coordinates | 326672..326941 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | IR04_RS01485 | Protein ID | WP_001258569.1 |
Coordinates | 326934..327212 (-) | Length | 93 a.a. |
Genomic Context
Location: 322162..322548 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 322605..322718 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 322667..322948 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 323206..323742 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 323879..324394 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 325703..325828 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 325844..325882 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 326078..326524 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 327498..327776 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 328028..328234 (207 bp)
Type: Others
Protein ID: Protein_290
Type: Others
Protein ID: Protein_290
Location: 328434..328535 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 328525..328911 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 329106..329357 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 329330..329479 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 329571..329813 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 330065..330343 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 330718..330861 (144 bp)
Type: Others
Protein ID: Protein_297
Type: Others
Protein ID: Protein_297
Location: 330915..330953 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 331165..331632 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 321676..321918 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 324544..325041 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 325038..325310 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 326672..326941 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 326934..327212 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IR04_RS01430 | 321676..321918 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
IR04_RS01435 | 322162..322548 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
IR04_RS19160 | 322605..322718 | + | 114 | WP_001900214.1 | hypothetical protein | - |
IR04_RS01440 | 322667..322948 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
IR04_RS01450 | 323206..323742 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
IR04_RS01455 | 323879..324394 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
IR04_RS01460 | 324544..325041 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
IR04_RS01465 | 325038..325310 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
IR04_RS19885 | 325703..325828 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
IR04_RS19890 | 325844..325882 | + | 39 | WP_106019118.1 | hypothetical protein | - |
IR04_RS01475 | 326078..326524 | + | 447 | WP_000006157.1 | hypothetical protein | - |
IR04_RS01480 | 326672..326941 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
IR04_RS01485 | 326934..327212 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
IR04_RS19175 | 327498..327776 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
IR04_RS19905 | 328028..328234 | + | 207 | Protein_290 | DUF3709 domain-containing protein | - |
IR04_RS19910 | 328434..328535 | + | 102 | WP_001921603.1 | hypothetical protein | - |
IR04_RS01495 | 328525..328911 | + | 387 | WP_000703163.1 | VOC family protein | - |
IR04_RS01500 | 329106..329357 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
IR04_RS19185 | 329330..329479 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
IR04_RS01505 | 329571..329813 | + | 243 | WP_000107461.1 | hypothetical protein | - |
IR04_RS01510 | 330065..330343 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
IR04_RS20380 | 330718..330861 | + | 144 | Protein_297 | DUF645 family protein | - |
IR04_RS20385 | 330915..330953 | + | 39 | WP_082798268.1 | hypothetical protein | - |
IR04_RS01515 | 331165..331632 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..409892 | 105192 | |
inside | Integron | - | - | 309780..409516 | 99736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T48147 WP_000277238.1 NZ_CP009041:c326941-326672 [Vibrio cholerae O1 biovar El Tor]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T48147 NZ_CP009041:c326941-326672 [Vibrio cholerae O1 biovar El Tor]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT48147 WP_001258569.1 NZ_CP009041:c327212-326934 [Vibrio cholerae O1 biovar El Tor]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT48147 NZ_CP009041:c327212-326934 [Vibrio cholerae O1 biovar El Tor]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |