293793

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 325886..326652 Replicon chromosome
Accession NZ_LT906615
Organism Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag FY484_RS15385 Protein ID WP_000982260.1
Coordinates 325886..326383 (-) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag FY484_RS15390 Protein ID WP_000246253.1
Coordinates 326380..326652 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FY484_RS15325 321328..322032 + 705 WP_000087610.1 HNH endonuclease -
FY484_RS15330 322190..322528 + 339 WP_000713853.1 hypothetical protein -
FY484_RS15340 322682..322999 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin -
FY484_RS15345 323018..323260 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
FY484_RS15350 323504..323890 + 387 WP_001015867.1 NUDIX hydrolase -
FY484_RS15355 323947..324060 + 114 WP_001900214.1 hypothetical protein -
FY484_RS15360 324009..324290 + 282 WP_001894429.1 DUF1289 domain-containing protein -
FY484_RS15375 324548..325084 + 537 WP_000469482.1 GNAT family N-acetyltransferase -
FY484_RS15380 325221..325736 + 516 WP_001201509.1 lipocalin family protein -
FY484_RS15385 325886..326383 - 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
FY484_RS15390 326380..326652 - 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
FY484_RS15395 327045..327170 + 126 WP_001900195.1 DUF645 family protein -
FY484_RS15400 327186..327224 + 39 WP_106019118.1 hypothetical protein -
FY484_RS15410 327420..327866 + 447 WP_000006157.1 hypothetical protein -
FY484_RS15415 328014..328283 - 270 WP_000277238.1 type II toxin-antitoxin system YafQ family toxin -
FY484_RS15420 328276..328554 - 279 WP_001258569.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
FY484_RS15430 328840..329118 + 279 WP_001921601.1 DUF3709 domain-containing protein -
FY484_RS15435 329370..329576 + 207 Protein_292 DUF3709 domain-containing protein -
FY484_RS15440 329776..329877 + 102 WP_001921603.1 hypothetical protein -
FY484_RS15445 329867..330253 + 387 WP_000703163.1 VOC family protein -
FY484_RS15450 330448..330699 + 252 WP_001890111.1 TIGR03643 family protein -
FY484_RS15455 330672..330821 + 150 WP_071908333.1 DUF3265 domain-containing protein -
FY484_RS15460 330913..331155 + 243 WP_000107461.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T293793 WP_000982260.1 NZ_LT906615:c326383-325886 [Vibrio cholerae O1 biovar El Tor str. N16961]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT293793 WP_000246253.1 NZ_LT906615:c326652-326380 [Vibrio cholerae O1 biovar El Tor str. N16961]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References