Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 338286..338824 | Replicon | chromosome |
Accession | NZ_CP090379 | ||
Organism | Vibrio cholerae strain BY369 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | LVJ30_RS15430 | Protein ID | WP_000802136.1 |
Coordinates | 338286..338585 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | LVJ30_RS15435 | Protein ID | WP_001107719.1 |
Coordinates | 338582..338824 (-) | Length | 81 a.a. |
Genomic Context
Location: 333926..334042 (117 bp)
Type: Others
Protein ID: WP_086010881.1
Type: Others
Protein ID: WP_086010881.1
Location: 334032..334160 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 334221..334403 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 334603..335076 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 335091..335183 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 335225..335851 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 335974..336672 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 336703..336792 (90 bp)
Type: Others
Protein ID: WP_072606010.1
Type: Others
Protein ID: WP_072606010.1
Location: 337370..337549 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Location: 337763..338158 (396 bp)
Type: Others
Protein ID: WP_000870857.1
Type: Others
Protein ID: WP_000870857.1
Location: 339053..339631 (579 bp)
Type: Others
Protein ID: WP_000110120.1
Type: Others
Protein ID: WP_000110120.1
Location: 339653..339745 (93 bp)
Type: Others
Protein ID: WP_014164112.1
Type: Others
Protein ID: WP_014164112.1
Location: 340169..340852 (684 bp)
Type: Others
Protein ID: WP_000877436.1
Type: Others
Protein ID: WP_000877436.1
Location: 341066..341332 (267 bp)
Type: Others
Protein ID: WP_000937852.1
Type: Others
Protein ID: WP_000937852.1
Location: 341487..342086 (600 bp)
Type: Others
Protein ID: WP_000429495.1
Type: Others
Protein ID: WP_000429495.1
Location: 342367..343302 (936 bp)
Type: Others
Protein ID: WP_000051985.1
Type: Others
Protein ID: WP_000051985.1
Location: 343268..343408 (141 bp)
Type: Others
Protein ID: WP_001883049.1
Type: Others
Protein ID: WP_001883049.1
Location: 338286..338585 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 338582..338824 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LVJ30_RS15380 (LVJ30_15385) | 333926..334042 | + | 117 | WP_086010881.1 | DUF3265 domain-containing protein | - |
LVJ30_RS15385 (LVJ30_15390) | 334032..334160 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
LVJ30_RS15390 (LVJ30_15395) | 334221..334403 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
LVJ30_RS15395 (LVJ30_15400) | 334603..335076 | + | 474 | WP_001161076.1 | GrpB family protein | - |
LVJ30_RS15400 (LVJ30_15405) | 335091..335183 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
LVJ30_RS15405 (LVJ30_15410) | 335225..335851 | + | 627 | WP_000365424.1 | LysE family translocator | - |
LVJ30_RS15410 (LVJ30_15415) | 335974..336672 | + | 699 | WP_001890502.1 | hypothetical protein | - |
LVJ30_RS15415 (LVJ30_15420) | 336703..336792 | + | 90 | WP_072606010.1 | DUF3265 domain-containing protein | - |
LVJ30_RS15420 (LVJ30_15425) | 337370..337549 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
LVJ30_RS15425 (LVJ30_15430) | 337763..338158 | + | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
LVJ30_RS15430 (LVJ30_15435) | 338286..338585 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LVJ30_RS15435 (LVJ30_15440) | 338582..338824 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
LVJ30_RS15440 (LVJ30_15445) | 339053..339631 | + | 579 | WP_000110120.1 | hypothetical protein | - |
LVJ30_RS15445 (LVJ30_15450) | 339653..339745 | + | 93 | WP_014164112.1 | DUF3265 domain-containing protein | - |
LVJ30_RS15450 (LVJ30_15455) | 340169..340852 | + | 684 | WP_000877436.1 | hypothetical protein | - |
LVJ30_RS15455 (LVJ30_15460) | 341066..341332 | + | 267 | WP_000937852.1 | hypothetical protein | - |
LVJ30_RS15460 (LVJ30_15465) | 341487..342086 | + | 600 | WP_000429495.1 | DUF6338 family protein | - |
LVJ30_RS15465 (LVJ30_15470) | 342367..343302 | + | 936 | WP_000051985.1 | restriction endonuclease | - |
LVJ30_RS15470 (LVJ30_15475) | 343268..343408 | + | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304645..399892 | 95247 | |
inside | Integron | - | - | 309725..399516 | 89791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T230519 WP_000802136.1 NZ_CP090379:c338585-338286 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T230519 NZ_CP124916:c2658201-2658100 [Enterococcus faecalis]
TTGTCAATCGAAGCGGCATTGGAATTGATGATTAGTTTTGCAGCGTTTGTTGCACTACTGATTTTCGGTATCCTTGAAGC
AACGAAAAACGATAAAAAATAA
TTGTCAATCGAAGCGGCATTGGAATTGATGATTAGTTTTGCAGCGTTTGTTGCACTACTGATTTTCGGTATCCTTGAAGC
AACGAAAAACGATAAAAAATAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT230519 WP_001107719.1 NZ_CP090379:c338824-338582 [Vibrio cholerae]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT230519 NZ_CP124916:2657976-2658155 [Enterococcus faecalis]
TGAAAAGAGAGATATGCTACTACATACCTCTCCTTTATACCAACACCAGTTATAAGAACTGGTGGCTTACTGAGTTAAGT
TTTTGTTGTTCTTTAACCGTTCAGCCGTCTAAGCTTATGAACGGTTATTTTTTATCGTTTTTCGTTGCTTCAAGGATACC
GAAAATCAGTAGTGCAACAA
TGAAAAGAGAGATATGCTACTACATACCTCTCCTTTATACCAACACCAGTTATAAGAACTGGTGGCTTACTGAGTTAAGT
TTTTGTTGTTCTTTAACCGTTCAGCCGTCTAAGCTTATGAACGGTTATTTTTTATCGTTTTTCGTTGCTTCAAGGATACC
GAAAATCAGTAGTGCAACAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |