Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 172070..172648 | Replicon | chromosome |
Accession | NZ_CP033513 | ||
Organism | Vibrio cholerae strain E4 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | EEL44_RS01030 | Protein ID | WP_001180243.1 |
Coordinates | 172331..172648 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | EEL44_RS01025 | Protein ID | WP_000557292.1 |
Coordinates | 172070..172312 (+) | Length | 81 a.a. |
Genomic Context
Location: 172070..172312 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Location: 172331..172648 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 167495..167533 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 167549..167674 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 167851..167961 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 167958..168275 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 168286..168573 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 168840..169020 (181 bp)
Type: Others
Protein ID: Protein_181
Type: Others
Protein ID: Protein_181
Location: 169445..169678 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 170081..170299 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 170609..171262 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 171319..171828 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 172842..172937 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 173293..173586 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 173733..174080 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 174229..174654 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 174850..175029 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 175326..175862 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 176006..176401 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 176578..176759 (182 bp)
Type: Others
Protein ID: Protein_195
Type: Others
Protein ID: Protein_195
Location: 177062..177457 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EEL44_RS00970 | 167495..167533 | - | 39 | WP_106019119.1 | hypothetical protein | - |
EEL44_RS00975 | 167549..167674 | - | 126 | WP_001944767.1 | DUF645 family protein | - |
EEL44_RS21145 | 167851..167961 | - | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
EEL44_RS00990 | 167958..168275 | - | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
EEL44_RS00995 | 168286..168573 | - | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
EEL44_RS01000 | 168840..169020 | - | 181 | Protein_181 | DUF645 family protein | - |
EEL44_RS01005 | 169445..169678 | - | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
EEL44_RS01010 | 170081..170299 | - | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
EEL44_RS01015 | 170609..171262 | - | 654 | WP_000226874.1 | hypothetical protein | - |
EEL44_RS01020 | 171319..171828 | - | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
EEL44_RS01025 | 172070..172312 | + | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EEL44_RS01030 | 172331..172648 | + | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EEL44_RS21150 | 172842..172937 | - | 96 | WP_001907607.1 | DUF645 family protein | - |
EEL44_RS20965 | 173293..173586 | - | 294 | WP_125460920.1 | hypothetical protein | - |
EEL44_RS01050 | 173733..174080 | - | 348 | WP_000933409.1 | hypothetical protein | - |
EEL44_RS01055 | 174229..174654 | - | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
EEL44_RS01060 | 174850..175029 | - | 180 | WP_001883039.1 | DUF645 family protein | - |
EEL44_RS01065 | 175326..175862 | - | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
EEL44_RS01070 | 176006..176401 | - | 396 | WP_000046953.1 | hypothetical protein | - |
EEL44_RS01075 | 176578..176759 | - | 182 | Protein_195 | DUF645 family protein | - |
EEL44_RS01080 | 177062..177457 | - | 396 | WP_000046952.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integron | - | - | 127139..226875 | 99736 | ||
- | inside | Genomic island | catB9 | - | 126763..233717 | 106954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T113805 WP_001180243.1 NZ_CP033513:172331-172648 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T113805 NZ_CP033513:172331-172648 [Vibrio cholerae]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT113805 WP_000557292.1 NZ_CP033513:172070-172312 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT113805 NZ_CP033513:172070-172312 [Vibrio cholerae]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |