Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 332541..333039 | Replicon | chromosome |
Accession | NZ_CP012666 | ||
Organism | Vibrio cholerae strain ICDC-VC661 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | AN947_RS01650 | Protein ID | WP_000589156.1 |
Coordinates | 332541..332807 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | AN947_RS01655 | Protein ID | WP_000643598.1 |
Coordinates | 332794..333039 (+) | Length | 82 a.a. |
Genomic Context
Location: 327962..328168 (207 bp)
Type: Others
Protein ID: Protein_290
Type: Others
Protein ID: Protein_290
Location: 328368..328469 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 328459..328845 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 329040..329291 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 329264..329413 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 329505..329747 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 329999..330277 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 330652..330795 (144 bp)
Type: Others
Protein ID: Protein_297
Type: Others
Protein ID: Protein_297
Location: 330849..330887 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 331099..331566 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 331694..332356 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 332541..332807 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 332794..333039 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 333135..333929 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 334032..334160 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 334221..334403 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 334603..335076 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 335091..335183 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 335225..335851 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 335974..336672 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 336682..336792 (111 bp)
Type: Others
Protein ID: WP_079857360.1
Type: Others
Protein ID: WP_079857360.1
Location: 337370..337549 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AN947_RS20720 | 327962..328168 | + | 207 | Protein_290 | DUF3709 domain-containing protein | - |
AN947_RS20725 | 328368..328469 | + | 102 | WP_001921603.1 | hypothetical protein | - |
AN947_RS01590 | 328459..328845 | + | 387 | WP_000703163.1 | VOC family protein | - |
AN947_RS01595 | 329040..329291 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
AN947_RS01600 | 329264..329413 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
AN947_RS01605 | 329505..329747 | + | 243 | WP_000107461.1 | hypothetical protein | - |
AN947_RS01610 | 329999..330277 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
AN947_RS20730 | 330652..330795 | + | 144 | Protein_297 | DUF645 family protein | - |
AN947_RS20735 | 330849..330887 | + | 39 | WP_082798268.1 | hypothetical protein | - |
AN947_RS01635 | 331099..331566 | + | 468 | WP_001289288.1 | OsmC family protein | - |
AN947_RS01640 | 331694..332356 | + | 663 | WP_000960654.1 | hypothetical protein | - |
AN947_RS01650 | 332541..332807 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
AN947_RS01655 | 332794..333039 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
AN947_RS01665 | 333135..333929 | + | 795 | WP_001911581.1 | hypothetical protein | - |
AN947_RS01675 | 334032..334160 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
AN947_RS01680 | 334221..334403 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
AN947_RS01685 | 334603..335076 | + | 474 | WP_001161076.1 | GrpB family protein | - |
AN947_RS01690 | 335091..335183 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
AN947_RS01695 | 335225..335851 | + | 627 | WP_000365424.1 | LysE family translocator | - |
AN947_RS01700 | 335974..336672 | + | 699 | WP_001890502.1 | hypothetical protein | - |
AN947_RS01705 | 336682..336792 | + | 111 | WP_079857360.1 | DUF3265 domain-containing protein | - |
AN947_RS01720 | 337370..337549 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304645..399892 | 95247 | |
inside | Integron | - | - | 309725..399516 | 89791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T56912 WP_000589156.1 NZ_CP012666:332541-332807 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T56912 NZ_CP012666:332541-332807 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT56912 WP_000643598.1 NZ_CP012666:332794-333039 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT56912 NZ_CP012666:332794-333039 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |