Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 422310..422838 | Replicon | chromosome |
Accession | NZ_CP028828 | ||
Organism | Vibrio cholerae strain N16961 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | N16961_RS16570 | Protein ID | WP_000221354.1 |
Coordinates | 422551..422838 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | N16961_RS16565 | Protein ID | WP_001250179.1 |
Coordinates | 422310..422561 (+) | Length | 84 a.a. |
Genomic Context
Location: 417578..417892 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 418029..418463 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 418631..418786 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 419959..420265 (307 bp)
Type: Others
Protein ID: Protein_448
Type: Others
Protein ID: Protein_448
Location: 420402..421094 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 421094..421495 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 421465..421608 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 421683..422096 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 422310..422561 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 422551..422838 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 422966..423421 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 423743..423895 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 425094..425762 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 425914..426201 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 426342..426713 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 426780..427205 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 427202..427735 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 418911..419891 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 424097..424594 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 424591..424863 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N16961_RS16525 | 417578..417892 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
N16961_RS16530 | 418029..418463 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
N16961_RS19670 | 418631..418786 | + | 156 | WP_000751734.1 | hypothetical protein | - |
N16961_RS16535 | 418911..419891 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
N16961_RS16540 | 419959..420265 | + | 307 | Protein_448 | CatB-related O-acetyltransferase | - |
N16961_RS16545 | 420402..421094 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
N16961_RS16550 | 421094..421495 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
N16961_RS16555 | 421465..421608 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
N16961_RS16560 | 421683..422096 | + | 414 | WP_000049417.1 | VOC family protein | - |
N16961_RS16565 | 422310..422561 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N16961_RS16570 | 422551..422838 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N16961_RS16575 | 422966..423421 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
N16961_RS16580 | 423743..423895 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
N16961_RS16590 | 424097..424594 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
N16961_RS16595 | 424591..424863 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
N16961_RS16600 | 425094..425762 | + | 669 | WP_000043871.1 | hypothetical protein | - |
N16961_RS16605 | 425914..426201 | + | 288 | WP_000426470.1 | hypothetical protein | - |
N16961_RS16610 | 426342..426713 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
N16961_RS16615 | 426780..427205 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
N16961_RS16620 | 427202..427735 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306977..438073 | 131096 | |
inside | Integron | - | - | 312057..437697 | 125640 | ||
flank | IS/Tn | - | - | 418911..419891 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T104258 WP_000221354.1 NZ_CP028828:422551-422838 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T104258 NZ_CP028828:422551-422838 [Vibrio cholerae]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT104258 WP_001250179.1 NZ_CP028828:422310-422561 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT104258 NZ_CP028828:422310-422561 [Vibrio cholerae]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |