Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 93210..93843 | Replicon | chromosome |
Accession | NZ_AP024548 | ||
Organism | Vibrio cholerae strain BCH-01536 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | K6J77_RS14605 | Protein ID | WP_000843587.1 |
Coordinates | 93210..93542 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | K6J77_RS14610 | Protein ID | WP_000071008.1 |
Coordinates | 93529..93843 (+) | Length | 105 a.a. |
Genomic Context
Location: 88645..88854 (210 bp)
Type: Others
Protein ID: WP_221277753.1
Type: Others
Protein ID: WP_221277753.1
Location: 89111..89308 (198 bp)
Type: Others
Protein ID: WP_001894451.1
Type: Others
Protein ID: WP_001894451.1
Location: 89668..89937 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 90273..90426 (154 bp)
Type: Others
Protein ID: Protein_166
Type: Others
Protein ID: Protein_166
Location: 90635..91021 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 91106..91465 (360 bp)
Type: Others
Protein ID: WP_226979446.1
Type: Others
Protein ID: WP_226979446.1
Location: 91636..92013 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 92070..92184 (115 bp)
Type: Others
Protein ID: Protein_170
Type: Others
Protein ID: Protein_170
Location: 92193..92414 (222 bp)
Type: Others
Protein ID: WP_032468461.1
Type: Others
Protein ID: WP_032468461.1
Location: 92580..92693 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 92642..92869 (228 bp)
Type: Others
Protein ID: WP_073426587.1
Type: Others
Protein ID: WP_073426587.1
Location: 93210..93542 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 93529..93843 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 93980..94414 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 94582..94737 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 95910..96216 (307 bp)
Type: Others
Protein ID: Protein_179
Type: Others
Protein ID: Protein_179
Location: 96353..96751 (399 bp)
Type: Others
Protein ID: Protein_180
Type: Others
Protein ID: Protein_180
Location: 96875..97045 (171 bp)
Type: Others
Protein ID: WP_001080654.1
Type: Others
Protein ID: WP_001080654.1
Location: 97045..97446 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 97449..97559 (111 bp)
Type: Others
Protein ID: WP_082798255.1
Type: Others
Protein ID: WP_082798255.1
Location: 97634..98047 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 98261..98512 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 98502..98789 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 94862..95842 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J77_RS14550 | 88645..88854 | + | 210 | WP_221277753.1 | hypothetical protein | - |
K6J77_RS14555 | 89111..89308 | + | 198 | WP_001894451.1 | DUF3709 domain-containing protein | - |
K6J77_RS14560 | 89668..89937 | + | 270 | WP_001198131.1 | hypothetical protein | - |
K6J77_RS14565 | 90273..90426 | + | 154 | Protein_166 | DUF645 family protein | - |
K6J77_RS14570 | 90635..91021 | + | 387 | WP_000703163.1 | VOC family protein | - |
K6J77_RS14575 | 91106..91465 | + | 360 | WP_226979446.1 | pullulanase | - |
K6J77_RS14580 | 91636..92013 | + | 378 | WP_000411109.1 | hypothetical protein | - |
K6J77_RS14585 | 92070..92184 | + | 115 | Protein_170 | acetyltransferase | - |
K6J77_RS14590 | 92193..92414 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
K6J77_RS14595 | 92580..92693 | + | 114 | WP_001889158.1 | hypothetical protein | - |
K6J77_RS14600 | 92642..92869 | + | 228 | WP_073426587.1 | DUF1289 domain-containing protein | - |
K6J77_RS14605 | 93210..93542 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K6J77_RS14610 | 93529..93843 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
K6J77_RS14615 | 93980..94414 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
K6J77_RS14620 | 94582..94737 | + | 156 | WP_000751734.1 | hypothetical protein | - |
K6J77_RS14625 | 94862..95842 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
K6J77_RS14630 | 95910..96216 | + | 307 | Protein_179 | CatB-related O-acetyltransferase | - |
K6J77_RS19080 | 96353..96751 | + | 399 | Protein_180 | GNAT family N-acetyltransferase | - |
K6J77_RS19085 | 96875..97045 | + | 171 | WP_001080654.1 | hypothetical protein | - |
K6J77_RS14640 | 97045..97446 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
K6J77_RS19090 | 97449..97559 | + | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
K6J77_RS14645 | 97634..98047 | + | 414 | WP_000049417.1 | VOC family protein | - |
K6J77_RS14650 | 98261..98512 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
K6J77_RS14655 | 98502..98789 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integron | - | - | 11978..113648 | 101670 | ||
flank | IS/Tn | - | - | 88179..88598 | 419 | ||
flank | IS/Tn | - | - | 94862..95842 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T38625 WP_000843587.1 NZ_AP024548:93210-93542 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T38625 NZ_AP024548:93210-93542 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT38625 WP_000071008.1 NZ_AP024548:93529-93843 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT38625 NZ_AP024548:93529-93843 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA