Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 209443..209983 | Replicon | chromosome |
Accession | NZ_CP033513 | ||
Organism | Vibrio cholerae strain E4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | EEL44_RS01445 | Protein ID | WP_000277238.1 |
Coordinates | 209714..209983 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | EEL44_RS01440 | Protein ID | WP_001258569.1 |
Coordinates | 209443..209721 (+) | Length | 93 a.a. |
Genomic Context
Location: 209443..209721 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Location: 209714..209983 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 211345..211617 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 211614..212111 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 214737..214979 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 205023..205490 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 205702..205740 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 205794..205937 (144 bp)
Type: Others
Protein ID: Protein_245
Type: Others
Protein ID: Protein_245
Location: 206312..206590 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 206842..207084 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 207176..207325 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 207298..207549 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 207744..208130 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 208120..208221 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 208421..208627 (207 bp)
Type: Others
Protein ID: Protein_252
Type: Others
Protein ID: Protein_252
Location: 208879..209157 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 210131..210577 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 210773..210811 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 210827..210952 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 212261..212776 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 212913..213449 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 213707..213988 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 213937..214050 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 214107..214493 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EEL44_RS01375 | 205023..205490 | - | 468 | WP_001289288.1 | OsmC family protein | - |
EEL44_RS20970 | 205702..205740 | - | 39 | WP_082798268.1 | hypothetical protein | - |
EEL44_RS20975 | 205794..205937 | - | 144 | Protein_245 | DUF645 family protein | - |
EEL44_RS01395 | 206312..206590 | - | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
EEL44_RS01400 | 206842..207084 | - | 243 | WP_000107461.1 | hypothetical protein | - |
EEL44_RS01405 | 207176..207325 | - | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
EEL44_RS01410 | 207298..207549 | - | 252 | WP_001890111.1 | TIGR03643 family protein | - |
EEL44_RS01415 | 207744..208130 | - | 387 | WP_000703163.1 | VOC family protein | - |
EEL44_RS01420 | 208120..208221 | - | 102 | WP_001921603.1 | hypothetical protein | - |
EEL44_RS01425 | 208421..208627 | - | 207 | Protein_252 | DUF3709 domain-containing protein | - |
EEL44_RS01430 | 208879..209157 | - | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
EEL44_RS01440 | 209443..209721 | + | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EEL44_RS01445 | 209714..209983 | + | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
EEL44_RS01450 | 210131..210577 | - | 447 | WP_000006157.1 | hypothetical protein | - |
EEL44_RS01460 | 210773..210811 | - | 39 | WP_106019118.1 | hypothetical protein | - |
EEL44_RS01465 | 210827..210952 | - | 126 | WP_001900195.1 | DUF645 family protein | - |
EEL44_RS01470 | 211345..211617 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
EEL44_RS01475 | 211614..212111 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
EEL44_RS01480 | 212261..212776 | - | 516 | WP_001201509.1 | lipocalin family protein | - |
EEL44_RS01485 | 212913..213449 | - | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
EEL44_RS01500 | 213707..213988 | - | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
EEL44_RS01505 | 213937..214050 | - | 114 | WP_001900214.1 | hypothetical protein | - |
EEL44_RS01510 | 214107..214493 | - | 387 | WP_001015867.1 | NUDIX hydrolase | - |
EEL44_RS01515 | 214737..214979 | + | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 126763..233717 | 106954 | |
inside | Integron | - | - | 127139..226875 | 99736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T113809 WP_000277238.1 NZ_CP033513:209714-209983 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T113809 NZ_CP033513:209714-209983 [Vibrio cholerae]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT113809 WP_001258569.1 NZ_CP033513:209443-209721 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT113809 NZ_CP033513:209443-209721 [Vibrio cholerae]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |