Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-Phd |
| Location | 424636..425214 | Replicon | chromosome |
| Accession | NZ_LT992489 | ||
| Organism | Vibrio cholerae strain 4295STDY6534232 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | O68848 |
| Locus tag | DG176_RS16485 | Protein ID | WP_001180243.1 |
| Coordinates | 424897..425214 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q7DCR7 |
| Locus tag | DG176_RS16480 | Protein ID | WP_000557292.1 |
| Coordinates | 424636..424878 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG176_RS19810 | 420061..420099 | - | 39 | WP_106019119.1 | hypothetical protein | - |
| DG176_RS19815 | 420115..420240 | - | 126 | WP_001944767.1 | DUF645 family protein | - |
| DG176_RS19820 | 420417..420527 | - | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
| DG176_RS16445 | 420524..420841 | - | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
| DG176_RS16450 | 420852..421139 | - | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DG176_RS16455 | 421406..421586 | - | 181 | Protein_392 | DUF645 family protein | - |
| DG176_RS16460 | 422011..422244 | - | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
| DG176_RS16465 | 422647..422865 | - | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
| DG176_RS16470 | 423175..423828 | - | 654 | WP_000226874.1 | hypothetical protein | - |
| DG176_RS16475 | 423885..424394 | - | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
| DG176_RS16480 | 424636..424878 | + | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| DG176_RS16485 | 424897..425214 | + | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DG176_RS19825 | 425408..425503 | - | 96 | WP_001907607.1 | DUF645 family protein | - |
| DG176_RS19670 | 425859..426152 | - | 294 | WP_125460920.1 | hypothetical protein | - |
| DG176_RS16505 | 426299..426646 | - | 348 | WP_000933409.1 | hypothetical protein | - |
| DG176_RS16510 | 426795..427220 | - | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
| DG176_RS16515 | 427416..427595 | - | 180 | WP_001883039.1 | DUF645 family protein | - |
| DG176_RS16520 | 427892..428428 | - | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
| DG176_RS16525 | 428572..428967 | - | 396 | WP_000046953.1 | hypothetical protein | - |
| DG176_RS16530 | 429144..429325 | - | 182 | Protein_406 | DUF645 family protein | - |
| DG176_RS16535 | 429628..430023 | - | 396 | WP_000046952.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 379325..476297 | 96972 | |
| inside | Integron | catB9 | - | 379701..469509 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T294379 WP_001180243.1 NZ_LT992489:424897-425214 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K9UJR8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q7DCR7 |