294379

Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 424636..425214 Replicon chromosome
Accession NZ_LT992489
Organism Vibrio cholerae strain 4295STDY6534232

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag DG176_RS16485 Protein ID WP_001180243.1
Coordinates 424897..425214 (+) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag DG176_RS16480 Protein ID WP_000557292.1
Coordinates 424636..424878 (+) Length 81 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG176_RS19810 420061..420099 - 39 WP_106019119.1 hypothetical protein -
DG176_RS19815 420115..420240 - 126 WP_001944767.1 DUF645 family protein -
DG176_RS19820 420417..420527 - 111 WP_134814058.1 DUF3265 domain-containing protein -
DG176_RS16445 420524..420841 - 318 WP_001232701.1 HigA family addiction module antidote protein -
DG176_RS16450 420852..421139 - 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG176_RS16455 421406..421586 - 181 Protein_392 DUF645 family protein -
DG176_RS16460 422011..422244 - 234 WP_032482776.1 DUF3709 domain-containing protein -
DG176_RS16465 422647..422865 - 219 WP_001917086.1 DUF3709 domain-containing protein -
DG176_RS16470 423175..423828 - 654 WP_000226874.1 hypothetical protein -
DG176_RS16475 423885..424394 - 510 WP_000405987.1 GNAT family N-acetyltransferase -
DG176_RS16480 424636..424878 + 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG176_RS16485 424897..425214 + 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG176_RS19825 425408..425503 - 96 WP_001907607.1 DUF645 family protein -
DG176_RS19670 425859..426152 - 294 WP_125460920.1 hypothetical protein -
DG176_RS16505 426299..426646 - 348 WP_000933409.1 hypothetical protein -
DG176_RS16510 426795..427220 - 426 WP_000403014.1 GNAT family N-acetyltransferase -
DG176_RS16515 427416..427595 - 180 WP_001883039.1 DUF645 family protein -
DG176_RS16520 427892..428428 - 537 WP_000644491.1 nucleotidyltransferase family protein -
DG176_RS16525 428572..428967 - 396 WP_000046953.1 hypothetical protein -
DG176_RS16530 429144..429325 - 182 Protein_406 DUF645 family protein -
DG176_RS16535 429628..430023 - 396 WP_000046952.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 379325..476297 96972
inside Integron catB9 - 379701..469509 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T294379 WP_001180243.1 NZ_LT992489:424897-425214 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp


Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT294379 WP_000557292.1 NZ_LT992489:424636-424878 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8


Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References