Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 203550..204048 | Replicon | chromosome |
Accession | NZ_CP033513 | ||
Organism | Vibrio cholerae strain E4 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | EEL44_RS01360 | Protein ID | WP_000589156.1 |
Coordinates | 203782..204048 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | EEL44_RS01355 | Protein ID | WP_000643598.1 |
Coordinates | 203550..203795 (-) | Length | 82 a.a. |
Genomic Context
Location: 198631..199017 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 199174..199680 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 199948..200181 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 200454..200813 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 200966..201970 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 202186..202368 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 202429..202557 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 202660..203454 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 203550..203795 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 203782..204048 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 204233..204895 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 205023..205490 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 205702..205740 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 205794..205937 (144 bp)
Type: Others
Protein ID: Protein_245
Type: Others
Protein ID: Protein_245
Location: 206312..206590 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 206842..207084 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 207176..207325 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 207298..207549 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 207744..208130 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 208120..208221 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 208421..208627 (207 bp)
Type: Others
Protein ID: Protein_252
Type: Others
Protein ID: Protein_252
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EEL44_RS01310 | 198631..199017 | - | 387 | WP_000703163.1 | VOC family protein | - |
EEL44_RS01315 | 199174..199680 | - | 507 | WP_000393074.1 | hypothetical protein | - |
EEL44_RS01320 | 199948..200181 | - | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
EEL44_RS01325 | 200454..200813 | - | 360 | WP_001071541.1 | VOC family protein | - |
EEL44_RS01330 | 200966..201970 | - | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
EEL44_RS01335 | 202186..202368 | - | 183 | WP_000923182.1 | DUF645 family protein | - |
EEL44_RS01340 | 202429..202557 | - | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
EEL44_RS01350 | 202660..203454 | - | 795 | WP_001911581.1 | hypothetical protein | - |
EEL44_RS01355 | 203550..203795 | - | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
EEL44_RS01360 | 203782..204048 | - | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
EEL44_RS01370 | 204233..204895 | - | 663 | WP_000960654.1 | hypothetical protein | - |
EEL44_RS01375 | 205023..205490 | - | 468 | WP_001289288.1 | OsmC family protein | - |
EEL44_RS20970 | 205702..205740 | - | 39 | WP_082798268.1 | hypothetical protein | - |
EEL44_RS20975 | 205794..205937 | - | 144 | Protein_245 | DUF645 family protein | - |
EEL44_RS01395 | 206312..206590 | - | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
EEL44_RS01400 | 206842..207084 | - | 243 | WP_000107461.1 | hypothetical protein | - |
EEL44_RS01405 | 207176..207325 | - | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
EEL44_RS01410 | 207298..207549 | - | 252 | WP_001890111.1 | TIGR03643 family protein | - |
EEL44_RS01415 | 207744..208130 | - | 387 | WP_000703163.1 | VOC family protein | - |
EEL44_RS01420 | 208120..208221 | - | 102 | WP_001921603.1 | hypothetical protein | - |
EEL44_RS01425 | 208421..208627 | - | 207 | Protein_252 | DUF3709 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 126763..233717 | 106954 | |
inside | Integron | - | - | 127139..226875 | 99736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T113808 WP_000589156.1 NZ_CP033513:c204048-203782 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T113808 NZ_CP033513:c204048-203782 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT113808 WP_000643598.1 NZ_CP033513:c203795-203550 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT113808 NZ_CP033513:c203795-203550 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |