294362

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 970277..970817 Replicon chromosome
Accession NZ_LT992487
Organism Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)


Gene name relE Uniprot ID A0A151JGK8
Locus tag DG247_RS19105 Protein ID WP_000277238.1
Coordinates 970548..970817 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KML3
Locus tag DG247_RS19100 Protein ID WP_001258569.1
Coordinates 970277..970555 (+) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG247_RS19035 965857..966324 - 468 WP_001289288.1 OsmC family protein -
DG247_RS19845 966536..966574 - 39 WP_082798268.1 hypothetical protein -
DG247_RS19850 966628..966771 - 144 Protein_877 DUF645 family protein -
DG247_RS19055 967146..967424 - 279 WP_000280324.1 DUF3709 domain-containing protein -
DG247_RS19060 967676..967918 - 243 WP_000107461.1 hypothetical protein -
DG247_RS19065 968010..968159 - 150 WP_071908333.1 DUF3265 domain-containing protein -
DG247_RS19070 968132..968383 - 252 WP_001890111.1 TIGR03643 family protein -
DG247_RS19075 968578..968964 - 387 WP_000703163.1 VOC family protein -
DG247_RS19080 968954..969055 - 102 WP_001921603.1 hypothetical protein -
DG247_RS19085 969255..969461 - 207 Protein_884 DUF3709 domain-containing protein -
DG247_RS19090 969713..969991 - 279 WP_001921601.1 DUF3709 domain-containing protein -
DG247_RS19100 970277..970555 + 279 WP_001258569.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
DG247_RS19105 970548..970817 + 270 WP_000277238.1 type II toxin-antitoxin system YafQ family toxin Toxin
DG247_RS19110 970965..971411 - 447 WP_000006157.1 hypothetical protein -
DG247_RS19120 971607..971645 - 39 WP_106019118.1 hypothetical protein -
DG247_RS19125 971661..971786 - 126 WP_001900195.1 DUF645 family protein -
DG247_RS19130 972179..972451 + 273 WP_000246253.1 DUF1778 domain-containing protein -
DG247_RS19135 972448..972945 + 498 WP_000982260.1 GNAT family N-acetyltransferase -
DG247_RS19140 973095..973610 - 516 WP_001201509.1 lipocalin family protein -
DG247_RS19145 973747..974283 - 537 WP_000469482.1 GNAT family N-acetyltransferase -
DG247_RS19160 974541..974822 - 282 WP_001894429.1 DUF1289 domain-containing protein -
DG247_RS19165 974771..974884 - 114 WP_001900214.1 hypothetical protein -
DG247_RS19170 974941..975327 - 387 WP_001015867.1 NUDIX hydrolase -
DG247_RS19175 975571..975813 + 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 897525..994497 96972
inside Integron catB9 - 897901..987709 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-85)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10406.11 Da        Isoelectric Point: 9.5084

>T294362 WP_000277238.1 NZ_LT992487:970548-970817 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF

Download         Length: 270 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10088.58 Da        Isoelectric Point: 6.0728

>AT294362 WP_001258569.1 NZ_LT992487:970277-970555 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A151JGK8

Antitoxin

Source ID Structure
AlphaFold DB A0A151KTP9

References