254467

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 737137..737677 Replicon chromosome
Accession NZ_CP102928
Organism Vibrio cholerae strain N1252

Toxin (Protein)


Gene name relE Uniprot ID A0A151JGK8
Locus tag NW313_RS17155 Protein ID WP_000277238.1
Coordinates 737137..737406 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KML3
Locus tag NW313_RS17160 Protein ID WP_001258569.1
Coordinates 737399..737677 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW313_RS17115 732358..732894 + 537 WP_000469482.1 GNAT family protein -
NW313_RS17120 733085..733546 + 462 WP_001903091.1 lipocalin family protein -
NW313_RS17125 733611..733679 + 69 Protein_648 acetyltransferase -
NW313_RS17130 733696..734193 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
NW313_RS17135 734190..734462 - 273 WP_000246253.1 DUF1778 domain-containing protein -
NW313_RS17140 734855..734980 + 126 WP_001900195.1 DUF645 family protein -
NW313_RS17145 735230..735676 + 447 WP_000006157.1 hypothetical protein -
NW313_RS17150 735739..736950 + 1212 WP_001122813.1 IS256 family transposase -
NW313_RS17155 737137..737406 - 270 WP_000277238.1 type II toxin-antitoxin system YafQ family toxin Toxin
NW313_RS17160 737399..737677 - 279 WP_001258569.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NW313_RS17165 737728..737845 + 118 Protein_656 DUF3265 domain-containing protein -
NW313_RS17170 737963..738241 + 279 WP_001921601.1 DUF3709 domain-containing protein -
NW313_RS17175 738601..738699 + 99 WP_223225486.1 DUF3709 domain-containing protein -
NW313_RS17180 738899..739000 + 102 WP_001921603.1 hypothetical protein -
NW313_RS17185 738990..739376 + 387 WP_000703163.1 VOC family protein -
NW313_RS17190 739571..739822 + 252 WP_001890111.1 TIGR03643 family protein -
NW313_RS17195 739795..739944 + 150 WP_071908333.1 DUF3265 domain-containing protein -
NW313_RS17200 740036..740278 + 243 WP_000107461.1 hypothetical protein -
NW313_RS17205 740530..740808 + 279 WP_000280324.1 DUF3709 domain-containing protein -
NW313_RS17210 741240..741283 + 44 Protein_665 hypothetical protein -
NW313_RS17215 741265..741358 + 94 Protein_666 ggdef family protein -
NW313_RS17220 741327..741458 + 132 WP_001883067.1 hypothetical protein -
NW313_RS17225 741630..742097 + 468 WP_001289288.1 OsmC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 713852..820357 106505
inside Integron catB9 - 718932..819981 101049
- flank IS/Tn - - 735739..736950 1211


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-85)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10406.11 Da        Isoelectric Point: 9.5084

>T254467 WP_000277238.1 NZ_CP102928:c737406-737137 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF

Download         Length: 270 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10088.58 Da        Isoelectric Point: 6.0728

>AT254467 WP_001258569.1 NZ_CP102928:c737677-737399 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A151JGK8

Antitoxin

Source ID Structure
AlphaFold DB A0A151KTP9

References