Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
| Location | 414947..415580 | Replicon | chromosome |
| Accession | NZ_LT906615 | ||
| Organism | Vibrio cholerae O1 biovar El Tor str. N16961 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q9KMA6 |
| Locus tag | FY484_RS16370 | Protein ID | WP_000843587.1 |
| Coordinates | 414947..415279 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | FY484_RS16375 | Protein ID | WP_000071008.1 |
| Coordinates | 415266..415580 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FY484_RS19545 | 410388..410591 | + | 204 | WP_001911745.1 | hypothetical protein | - |
| FY484_RS16300 | 410872..411045 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
| FY484_RS16305 | 411405..411674 | + | 270 | WP_001198131.1 | hypothetical protein | - |
| FY484_RS19610 | 411992..412163 | + | 172 | Protein_433 | DUF645 family protein | - |
| FY484_RS16320 | 412372..412758 | + | 387 | WP_000703163.1 | VOC family protein | - |
| FY484_RS16325 | 412960..413202 | + | 243 | WP_172625548.1 | hypothetical protein | - |
| FY484_RS16330 | 413373..413750 | + | 378 | WP_000411109.1 | hypothetical protein | - |
| FY484_RS19560 | 413807..413921 | + | 115 | Protein_437 | acetyltransferase | - |
| FY484_RS16335 | 413870..414151 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
| FY484_RS16350 | 414317..414430 | + | 114 | WP_001889158.1 | hypothetical protein | - |
| FY484_RS16355 | 414379..414606 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
| FY484_RS16370 | 414947..415279 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FY484_RS16375 | 415266..415580 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
| FY484_RS16380 | 415717..416151 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
| FY484_RS19565 | 416319..416474 | + | 156 | WP_000751734.1 | hypothetical protein | - |
| FY484_RS16385 | 416599..417579 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
| FY484_RS16390 | 417647..417953 | + | 307 | Protein_446 | CatB-related O-acetyltransferase | - |
| FY484_RS16395 | 418090..418782 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
| FY484_RS16400 | 418782..419183 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| FY484_RS16405 | 419153..419296 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
| FY484_RS16410 | 419371..419784 | + | 414 | WP_000049417.1 | VOC family protein | - |
| FY484_RS16415 | 419998..420249 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| FY484_RS16420 | 420239..420526 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
| inside | Integron | catB9 | - | 309746..435385 | 125639 | ||
| flank | IS/Tn | - | - | 416599..417579 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T293801 WP_000843587.1 NZ_LT906615:414947-415279 [Vibrio cholerae O1 biovar El Tor str. N16961]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT293801 WP_000071008.1 NZ_LT906615:415266-415580 [Vibrio cholerae O1 biovar El Tor str. N16961]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|