Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 418478..419111 | Replicon | chromosome |
Accession | NZ_CP047300 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain P27459 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | GTF71_RS15700 | Protein ID | WP_000843587.1 |
Coordinates | 418478..418810 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | GTF71_RS15705 | Protein ID | WP_000071008.1 |
Coordinates | 418797..419111 (+) | Length | 105 a.a. |
Genomic Context
Location: 413919..414122 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 414403..414576 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 414936..415205 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 415516..415602 (87 bp)
Type: Others
Protein ID: WP_134820423.1
Type: Others
Protein ID: WP_134820423.1
Location: 415602..415694 (93 bp)
Type: Others
Protein ID: Protein_441
Type: Others
Protein ID: Protein_441
Location: 415903..416289 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 416491..416733 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 416904..417281 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 417461..417682 (222 bp)
Type: Others
Protein ID: WP_032468461.1
Type: Others
Protein ID: WP_032468461.1
Location: 417848..417961 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 417910..418137 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 418478..418810 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 418797..419111 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 419248..419682 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 419850..420005 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 421178..421450 (273 bp)
Type: Others
Protein ID: Protein_455
Type: Others
Protein ID: Protein_455
Location: 421621..422313 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 422313..422714 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 422684..422827 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 422902..423315 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 423529..423780 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 423770..424057 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 417658..417816 (159 bp)
Type: Others
Protein ID: WP_001894455.1
Type: Others
Protein ID: WP_001894455.1
Location: 418167..418325 (159 bp)
Type: Others
Protein ID: WP_001882309.1
Type: Others
Protein ID: WP_001882309.1
Location: 420130..421110 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF71_RS15635 | 413919..414122 | + | 204 | WP_001911745.1 | hypothetical protein | - |
GTF71_RS15640 | 414403..414576 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
GTF71_RS15645 | 414936..415205 | + | 270 | WP_001198131.1 | hypothetical protein | - |
GTF71_RS15650 | 415516..415602 | + | 87 | WP_134820423.1 | DUF645 family protein | - |
GTF71_RS15655 | 415602..415694 | + | 93 | Protein_441 | DUF645 family protein | - |
GTF71_RS15660 | 415903..416289 | + | 387 | WP_000703163.1 | VOC family protein | - |
GTF71_RS15665 | 416491..416733 | + | 243 | WP_000107461.1 | hypothetical protein | - |
GTF71_RS15670 | 416904..417281 | + | 378 | WP_000411109.1 | hypothetical protein | - |
GTF71_RS15675 | 417461..417682 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
GTF71_RS15680 | 417658..417816 | - | 159 | WP_001894455.1 | DUF1196 family protein | - |
GTF71_RS15685 | 417848..417961 | + | 114 | WP_001889158.1 | hypothetical protein | - |
GTF71_RS15690 | 417910..418137 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
GTF71_RS15695 | 418167..418325 | - | 159 | WP_001882309.1 | DUF1196 family protein | - |
GTF71_RS15700 | 418478..418810 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF71_RS15705 | 418797..419111 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
GTF71_RS15710 | 419248..419682 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
GTF71_RS15715 | 419850..420005 | + | 156 | WP_000751734.1 | hypothetical protein | - |
GTF71_RS15720 | 420130..421110 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
GTF71_RS15725 | 421178..421450 | + | 273 | Protein_455 | CatB-related O-acetyltransferase | - |
GTF71_RS15730 | 421621..422313 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
GTF71_RS15735 | 422313..422714 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
GTF71_RS15740 | 422684..422827 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
GTF71_RS15745 | 422902..423315 | + | 414 | WP_000049417.1 | VOC family protein | - |
GTF71_RS15750 | 423529..423780 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTF71_RS15755 | 423770..424057 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306926..439292 | 132366 | |
inside | Integron | - | - | 312006..438916 | 126910 | ||
flank | IS/Tn | - | - | 420130..421110 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T145853 WP_000843587.1 NZ_CP047300:418478-418810 [Vibrio cholerae O1 biovar El Tor]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T145853 NZ_CP062702:4415541-4415801 [Escherichia coli O157:H7]
TTGAACTCGGGACAATTTTCAAAGGATGTAAAACTTGCACAAAAGCGTCATAAGGATATGAATAAATTGAAATATCTTAT
GACGCTTCTTATCAATAATACTTTACCGCTTCCAGCTGTTTATAAAGACCACCCGCTGCAAGGTTCATGGAAAGGTTATC
GCGATGCTCATGTCGAACCGGACTGGATCCTGATTTACAAACTTACCGATAAACTTTTACGATTTGAGAGAACTGGAACT
CACGCGGCGCTCTTTGGGTAA
TTGAACTCGGGACAATTTTCAAAGGATGTAAAACTTGCACAAAAGCGTCATAAGGATATGAATAAATTGAAATATCTTAT
GACGCTTCTTATCAATAATACTTTACCGCTTCCAGCTGTTTATAAAGACCACCCGCTGCAAGGTTCATGGAAAGGTTATC
GCGATGCTCATGTCGAACCGGACTGGATCCTGATTTACAAACTTACCGATAAACTTTTACGATTTGAGAGAACTGGAACT
CACGCGGCGCTCTTTGGGTAA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT145853 WP_000071008.1 NZ_CP047300:418797-419111 [Vibrio cholerae O1 biovar El Tor]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT145853 NZ_CP062702:4415262-4415522 [Escherichia coli O157:H7]
ATGGCTGCTAACGCATTTGTTCGCGCCCGAATCGATGAAGATCTGAAGAATCAGGCGGCGGACGTACTGGCCGGGATGGG
GCTGACCATCTCTGACCTGGTTCGCATAACCCTCACAAAGGTCGCGCGTGAAAAGGCATTGCCGTTTGATTTACGCGAGC
CTAATCAATTAACCATTCAATCAATCAAAAACAGCGAAGCTGGCGTTGATGTTCATAAGGCCAAAGACGCCGATGATTTA
TTTGATAAATTAGGAGTTTAA
ATGGCTGCTAACGCATTTGTTCGCGCCCGAATCGATGAAGATCTGAAGAATCAGGCGGCGGACGTACTGGCCGGGATGGG
GCTGACCATCTCTGACCTGGTTCGCATAACCCTCACAAAGGTCGCGCGTGAAAAGGCATTGCCGTTTGATTTACGCGAGC
CTAATCAATTAACCATTCAATCAATCAAAAACAGCGAAGCTGGCGTTGATGTTCATAAGGCCAAAGACGCCGATGATTTA
TTTGATAAATTAGGAGTTTAA