Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 368082..368697 | Replicon | chromosome |
Accession | NZ_CP009041 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain FJ147 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMG5 |
Locus tag | IR04_RS01795 | Protein ID | WP_001162670.1 |
Coordinates | 368082..368369 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | IR04_RS01800 | Protein ID | WP_001232701.1 |
Coordinates | 368380..368697 (+) | Length | 106 a.a. |
Genomic Context
Location: 363718..363813 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 364827..365336 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 365393..366046 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 366356..366574 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 366977..367210 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 367635..367815 (181 bp)
Type: Others
Protein ID: Protein_361
Type: Others
Protein ID: Protein_361
Location: 368082..368369 (288 bp)
Type: Toxin
Protein ID: WP_001162670.1
Type: Toxin
Protein ID: WP_001162670.1
Location: 368380..368697 (318 bp)
Type: Antitoxin
Protein ID: WP_001232701.1
Type: Antitoxin
Protein ID: WP_001232701.1
Location: 368694..368804 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 368981..369106 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 369122..369160 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 369373..370377 (1005 bp)
Type: Others
Protein ID: WP_000964925.1
Type: Others
Protein ID: WP_000964925.1
Location: 370530..370976 (447 bp)
Type: Others
Protein ID: WP_000128977.1
Type: Others
Protein ID: WP_000128977.1
Location: 371096..372025 (930 bp)
Type: Others
Protein ID: WP_000335802.1
Type: Others
Protein ID: WP_000335802.1
Location: 372022..372132 (111 bp)
Type: Others
Protein ID: WP_071917832.1
Type: Others
Protein ID: WP_071917832.1
Location: 372160..372636 (477 bp)
Type: Others
Protein ID: WP_001047180.1
Type: Others
Protein ID: WP_001047180.1
Location: 372773..373288 (516 bp)
Type: Others
Protein ID: WP_001201528.1
Type: Others
Protein ID: WP_001201528.1
Location: 364007..364324 (318 bp)
Type: Others
Protein ID: WP_001180243.1
Type: Others
Protein ID: WP_001180243.1
Location: 364343..364585 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IR04_RS20395 | 363718..363813 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
IR04_RS01765 | 364007..364324 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
IR04_RS01770 | 364343..364585 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
IR04_RS01775 | 364827..365336 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
IR04_RS01780 | 365393..366046 | + | 654 | WP_000226874.1 | hypothetical protein | - |
IR04_RS01785 | 366356..366574 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
IR04_RS19310 | 366977..367210 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
IR04_RS01790 | 367635..367815 | + | 181 | Protein_361 | DUF645 family protein | - |
IR04_RS01795 | 368082..368369 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
IR04_RS01800 | 368380..368697 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | Antitoxin |
IR04_RS20400 | 368694..368804 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
IR04_RS20405 | 368981..369106 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
IR04_RS20410 | 369122..369160 | + | 39 | WP_106019119.1 | hypothetical protein | - |
IR04_RS01805 | 369373..370377 | + | 1005 | WP_000964925.1 | LD-carboxypeptidase | - |
IR04_RS01810 | 370530..370976 | + | 447 | WP_000128977.1 | hypothetical protein | - |
IR04_RS01815 | 371096..372025 | + | 930 | WP_000335802.1 | hypothetical protein | - |
IR04_RS19990 | 372022..372132 | + | 111 | WP_071917832.1 | DUF3265 domain-containing protein | - |
IR04_RS01820 | 372160..372636 | + | 477 | WP_001047180.1 | GNAT family N-acetyltransferase | - |
IR04_RS01825 | 372773..373288 | + | 516 | WP_001201528.1 | lipocalin family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..409892 | 105192 | |
inside | Integron | - | - | 309780..409516 | 99736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11349.95 Da Isoelectric Point: 6.7187
>T48152 WP_001162670.1 NZ_CP009041:368082-368369 [Vibrio cholerae O1 biovar El Tor]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
Download Length: 288 bp
>T48152 NZ_CP009041:368082-368369 [Vibrio cholerae O1 biovar El Tor]
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA
Antitoxin
Download Length: 106 a.a. Molecular weight: 11705.63 Da Isoelectric Point: 10.4711
>AT48152 WP_001232701.1 NZ_CP009041:368380-368697 [Vibrio cholerae O1 biovar El Tor]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
Download Length: 318 bp
>AT48152 NZ_CP009041:368380-368697 [Vibrio cholerae O1 biovar El Tor]
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F2HI36 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |