Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 395396..395924 | Replicon | chromosome |
Accession | NZ_CP047060 | ||
Organism | Vibrio cholerae isolate CTMA_1441 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | GQX72_RS15900 | Protein ID | WP_000221354.1 |
Coordinates | 395637..395924 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | GQX72_RS15895 | Protein ID | WP_001250179.1 |
Coordinates | 395396..395647 (+) | Length | 84 a.a. |
Genomic Context
Location: 390664..390978 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 391115..391549 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 391717..391872 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 393045..393351 (307 bp)
Type: Others
Protein ID: Protein_404
Type: Others
Protein ID: Protein_404
Location: 393488..394180 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 394180..394581 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 394551..394694 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 394769..395182 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 395396..395647 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 395637..395924 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 396052..396507 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 396829..396981 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 398180..398848 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 399000..399287 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 399428..399799 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 399866..400291 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 400288..400821 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 391997..392977 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 397183..397680 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 397677..397949 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GQX72_RS15850 | 390664..390978 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
GQX72_RS15855 | 391115..391549 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
GQX72_RS15860 | 391717..391872 | + | 156 | WP_000751734.1 | hypothetical protein | - |
GQX72_RS15865 | 391997..392977 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
GQX72_RS15870 | 393045..393351 | + | 307 | Protein_404 | CatB-related O-acetyltransferase | - |
GQX72_RS15875 | 393488..394180 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
GQX72_RS15880 | 394180..394581 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
GQX72_RS15885 | 394551..394694 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
GQX72_RS15890 | 394769..395182 | + | 414 | WP_000049417.1 | VOC family protein | - |
GQX72_RS15895 | 395396..395647 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
GQX72_RS15900 | 395637..395924 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GQX72_RS15905 | 396052..396507 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
GQX72_RS15910 | 396829..396981 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
GQX72_RS15920 | 397183..397680 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
GQX72_RS15925 | 397677..397949 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
GQX72_RS15930 | 398180..398848 | + | 669 | WP_000043871.1 | hypothetical protein | - |
GQX72_RS15935 | 399000..399287 | + | 288 | WP_000426470.1 | hypothetical protein | - |
GQX72_RS15940 | 399428..399799 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
GQX72_RS19055 | 399866..400291 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
GQX72_RS15950 | 400288..400821 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 305960..411159 | 105199 | |
inside | Integron | - | - | 311040..410783 | 99743 | ||
flank | IS/Tn | - | - | 391997..392977 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T145403 WP_000221354.1 NZ_CP047060:395637-395924 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T145403 NZ_CP062376:2303054-2303161 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT145403 WP_001250179.1 NZ_CP047060:395396-395647 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT145403 NZ_CP062376:c2303238-2303178 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |