Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 1015360..1015900 | Replicon | chromosome |
Accession | NZ_CP080466 | ||
Organism | Vibrio cholerae strain ICDC-VC3741 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | K1T75_RS18495 | Protein ID | WP_000277238.1 |
Coordinates | 1015631..1015900 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | K1T75_RS18490 | Protein ID | WP_001258569.1 |
Coordinates | 1015360..1015638 (+) | Length | 93 a.a. |
Genomic Context
Location: 1015360..1015638 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Location: 1015631..1015900 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 1017262..1017534 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 1017531..1018028 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 1020654..1020896 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 1010940..1011407 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 1011579..1011710 (132 bp)
Type: Others
Protein ID: WP_001883067.1
Type: Others
Protein ID: WP_001883067.1
Location: 1012229..1012507 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 1012759..1013001 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 1013093..1013242 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 1013215..1013466 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 1013661..1014047 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 1014037..1014138 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 1014338..1014436 (99 bp)
Type: Others
Protein ID: WP_223225486.1
Type: Others
Protein ID: WP_223225486.1
Location: 1014796..1015074 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 1015192..1015309 (118 bp)
Type: Others
Protein ID: Protein_963
Type: Others
Protein ID: Protein_963
Location: 1016048..1016494 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 1016744..1016869 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 1018045..1018113 (69 bp)
Type: Others
Protein ID: Protein_970
Type: Others
Protein ID: Protein_970
Location: 1018178..1018639 (462 bp)
Type: Others
Protein ID: WP_001903091.1
Type: Others
Protein ID: WP_001903091.1
Location: 1018830..1019366 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 1019624..1019845 (222 bp)
Type: Others
Protein ID: WP_032467793.1
Type: Others
Protein ID: WP_032467793.1
Location: 1019854..1019967 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 1020024..1020410 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K1T75_RS18440 | 1010940..1011407 | - | 468 | WP_001289288.1 | OsmC family protein | - |
K1T75_RS18980 | 1011579..1011710 | - | 132 | WP_001883067.1 | hypothetical protein | - |
K1T75_RS18455 | 1012229..1012507 | - | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
K1T75_RS18460 | 1012759..1013001 | - | 243 | WP_000107461.1 | hypothetical protein | - |
K1T75_RS18985 | 1013093..1013242 | - | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
K1T75_RS18465 | 1013215..1013466 | - | 252 | WP_001890111.1 | TIGR03643 family protein | - |
K1T75_RS18470 | 1013661..1014047 | - | 387 | WP_000703163.1 | VOC family protein | - |
K1T75_RS18475 | 1014037..1014138 | - | 102 | WP_001921603.1 | hypothetical protein | - |
K1T75_RS18990 | 1014338..1014436 | - | 99 | WP_223225486.1 | DUF3709 domain-containing protein | - |
K1T75_RS18485 | 1014796..1015074 | - | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
K1T75_RS18995 | 1015192..1015309 | - | 118 | Protein_963 | DUF3265 domain-containing protein | - |
K1T75_RS18490 | 1015360..1015638 | + | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
K1T75_RS18495 | 1015631..1015900 | + | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
K1T75_RS18500 | 1016048..1016494 | - | 447 | WP_000006157.1 | hypothetical protein | - |
K1T75_RS18510 | 1016744..1016869 | - | 126 | WP_001900195.1 | DUF645 family protein | - |
K1T75_RS18515 | 1017262..1017534 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
K1T75_RS18520 | 1017531..1018028 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
K1T75_RS19000 | 1018045..1018113 | - | 69 | Protein_970 | acetyltransferase | - |
K1T75_RS18525 | 1018178..1018639 | - | 462 | WP_001903091.1 | lipocalin family protein | - |
K1T75_RS18530 | 1018830..1019366 | - | 537 | WP_000469482.1 | GNAT family protein | - |
K1T75_RS18535 | 1019624..1019845 | - | 222 | WP_032467793.1 | DUF1289 domain-containing protein | - |
K1T75_RS18540 | 1019854..1019967 | - | 114 | WP_001900214.1 | hypothetical protein | - |
K1T75_RS18545 | 1020024..1020410 | - | 387 | WP_001015867.1 | NUDIX hydrolase | - |
K1T75_RS18550 | 1020654..1020896 | + | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 932680..1039634 | 106954 | |
inside | Integron | - | - | 933056..1032792 | 99736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T211920 WP_000277238.1 NZ_CP080466:1015631-1015900 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T211920 NZ_CP106849:1963258-1963635 [Edwardsiella ictaluri]
ATGGGCAAGAACTTGCGAAAACATAACAATATTGTTATGTTTCACTCCATGAACTACACTATTGAGTACTACAGCGAAGA
GGTTCGGCTTGAGGTCGATCAGTTGCCAATGGGTATGCGGGTTCGATACCAGCATCTCGTTGAACGCATGGAAATCTACG
GTAGTAATCTCGGAGAACCACACACAAGCCCTTTTGGCGATGGGCTTTTTGAGCTTCGAATCAAAGGCAGTGATGGCATC
GCCCGCGTGTTTTACTGCACTCTTACCGGAAAACGTATCGTCATGCTGCACAGCTTCATCAAGAAAACCCAGAAGACGCC
AAGCGCTGAACGTAAGAAGGCTGAAACCAGAATGAAGGAGGTAAAACATGGCTGGTAA
ATGGGCAAGAACTTGCGAAAACATAACAATATTGTTATGTTTCACTCCATGAACTACACTATTGAGTACTACAGCGAAGA
GGTTCGGCTTGAGGTCGATCAGTTGCCAATGGGTATGCGGGTTCGATACCAGCATCTCGTTGAACGCATGGAAATCTACG
GTAGTAATCTCGGAGAACCACACACAAGCCCTTTTGGCGATGGGCTTTTTGAGCTTCGAATCAAAGGCAGTGATGGCATC
GCCCGCGTGTTTTACTGCACTCTTACCGGAAAACGTATCGTCATGCTGCACAGCTTCATCAAGAAAACCCAGAAGACGCC
AAGCGCTGAACGTAAGAAGGCTGAAACCAGAATGAAGGAGGTAAAACATGGCTGGTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT211920 WP_001258569.1 NZ_CP080466:1015360-1015638 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT211920 NZ_CP106849:1963625-1963933 [Edwardsiella ictaluri]
ATGGCTGGTAAACGCACCCCCCCCACGATGACGCATGATGAAATGGCTGCAAAATGGATGGAAGACCCGGCATTTAAAGC
AGAATACGATGCCATCGAAGAGGAATACGCCCTACTCGATGAAATGCTCGCAGCCCGCAAAAACGCGGGGCTGACCCAGG
CGCAGGTCGCCGAACGTATGGGAACCAAGGCTACAGCGATCACTCGCATGGAAAGTAATTTAGCCTCCGGCCAAAGCGGG
CCATCATTCGCCACGCTGAAAAAATTTGCACACGCGACCGGCAAGAAACTGCAGATCCGGTTTGTCTGA
ATGGCTGGTAAACGCACCCCCCCCACGATGACGCATGATGAAATGGCTGCAAAATGGATGGAAGACCCGGCATTTAAAGC
AGAATACGATGCCATCGAAGAGGAATACGCCCTACTCGATGAAATGCTCGCAGCCCGCAAAAACGCGGGGCTGACCCAGG
CGCAGGTCGCCGAACGTATGGGAACCAAGGCTACAGCGATCACTCGCATGGAAAGTAATTTAGCCTCCGGCCAAAGCGGG
CCATCATTCGCCACGCTGAAAAAATTTGCACACGCGACCGGCAAGAAACTGCAGATCCGGTTTGTCTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |