Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 232924..233557 | Replicon | chromosome |
Accession | NZ_AP024554 | ||
Organism | Vibrio cholerae strain IDH-03329 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | K6J80_RS14970 | Protein ID | WP_000843587.1 |
Coordinates | 233225..233557 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | K6J80_RS14965 | Protein ID | WP_000071008.1 |
Coordinates | 232924..233238 (-) | Length | 105 a.a. |
Genomic Context
Location: 230925..231905 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 227978..228265 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 228255..228506 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 228720..229133 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 229208..229318 (111 bp)
Type: Others
Protein ID: WP_082798255.1
Type: Others
Protein ID: WP_082798255.1
Location: 229321..229722 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 229722..229892 (171 bp)
Type: Others
Protein ID: WP_001080654.1
Type: Others
Protein ID: WP_001080654.1
Location: 230016..230414 (399 bp)
Type: Others
Protein ID: Protein_219
Type: Others
Protein ID: Protein_219
Location: 230551..230857 (307 bp)
Type: Others
Protein ID: Protein_220
Type: Others
Protein ID: Protein_220
Location: 232030..232185 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 232353..232787 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 232924..233238 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 233225..233557 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 233898..234125 (228 bp)
Type: Others
Protein ID: WP_073426587.1
Type: Others
Protein ID: WP_073426587.1
Location: 234074..234187 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 234353..234574 (222 bp)
Type: Others
Protein ID: WP_032468461.1
Type: Others
Protein ID: WP_032468461.1
Location: 234583..234697 (115 bp)
Type: Others
Protein ID: Protein_229
Type: Others
Protein ID: Protein_229
Location: 234754..235131 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 235302..235661 (360 bp)
Type: Others
Protein ID: WP_226979446.1
Type: Others
Protein ID: WP_226979446.1
Location: 235746..236132 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 236341..236473 (133 bp)
Type: Others
Protein ID: Protein_233
Type: Others
Protein ID: Protein_233
Location: 236464..236589 (126 bp)
Type: Others
Protein ID: WP_080360924.1
Type: Others
Protein ID: WP_080360924.1
Location: 236830..237099 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 237459..237656 (198 bp)
Type: Others
Protein ID: WP_001894451.1
Type: Others
Protein ID: WP_001894451.1
Location: 237913..238116 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J80_RS14920 | 227978..228265 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
K6J80_RS14925 | 228255..228506 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
K6J80_RS14930 | 228720..229133 | - | 414 | WP_000049417.1 | VOC family protein | - |
K6J80_RS18960 | 229208..229318 | - | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
K6J80_RS14935 | 229321..229722 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
K6J80_RS18965 | 229722..229892 | - | 171 | WP_001080654.1 | hypothetical protein | - |
K6J80_RS18970 | 230016..230414 | - | 399 | Protein_219 | GNAT family N-acetyltransferase | - |
K6J80_RS14945 | 230551..230857 | - | 307 | Protein_220 | CatB-related O-acetyltransferase | - |
K6J80_RS14950 | 230925..231905 | + | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
K6J80_RS14955 | 232030..232185 | - | 156 | WP_000751734.1 | hypothetical protein | - |
K6J80_RS14960 | 232353..232787 | - | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
K6J80_RS14965 | 232924..233238 | - | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
K6J80_RS14970 | 233225..233557 | - | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K6J80_RS14975 | 233898..234125 | - | 228 | WP_073426587.1 | DUF1289 domain-containing protein | - |
K6J80_RS14980 | 234074..234187 | - | 114 | WP_001889158.1 | hypothetical protein | - |
K6J80_RS14985 | 234353..234574 | - | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
K6J80_RS14990 | 234583..234697 | - | 115 | Protein_229 | acetyltransferase | - |
K6J80_RS14995 | 234754..235131 | - | 378 | WP_000411109.1 | hypothetical protein | - |
K6J80_RS15000 | 235302..235661 | - | 360 | WP_226979446.1 | pullulanase | - |
K6J80_RS15005 | 235746..236132 | - | 387 | WP_000703163.1 | VOC family protein | - |
K6J80_RS15010 | 236341..236473 | - | 133 | Protein_233 | DUF645 family protein | - |
K6J80_RS18975 | 236464..236589 | - | 126 | WP_080360924.1 | general secretion pathway protein GspH | - |
K6J80_RS15015 | 236830..237099 | - | 270 | WP_001198131.1 | hypothetical protein | - |
K6J80_RS15020 | 237459..237656 | - | 198 | WP_001894451.1 | DUF3709 domain-containing protein | - |
K6J80_RS15025 | 237913..238116 | - | 204 | WP_001911745.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 213119..319686 | 106567 | |
inside | Integron | - | - | 213119..312856 | 99737 | ||
flank | IS/Tn | - | - | 230925..231905 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T38675 WP_000843587.1 NZ_AP024554:c233557-233225 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T38675 NZ_AP024554:c233557-233225 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT38675 WP_000071008.1 NZ_AP024554:c233238-232924 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT38675 NZ_AP024554:c233238-232924 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA