295392

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 410525..411103 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag OC617_RS15925 Protein ID WP_001180243.1
Coordinates 410525..410842 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag OC617_RS15930 Protein ID WP_000557292.1
Coordinates 410861..411103 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS15865 (CNRVC190243H_03134) 405755..406111 + 357 WP_001094969.1 DUF6404 family protein -
OC617_RS15870 406210..406353 + 144 Protein_396 acetyltransferase -
OC617_RS15875 406476..406595 + 120 WP_001900954.1 DUF645 family protein -
OC617_RS15880 (CNRVC190243H_03135) 406772..407167 + 396 WP_000046953.1 DUF6404 family protein -
OC617_RS15885 (CNRVC190243H_03136) 407311..407847 + 537 WP_000644491.1 nucleotidyltransferase family protein -
OC617_RS15890 408198..408260 + 63 Protein_400 DUF645 family protein -
OC617_RS15895 408250..408360 + 111 WP_223804330.1 Tfp pilus assembly protein -
OC617_RS15900 (CNRVC190243H_03137) 408519..408944 + 426 WP_000403014.1 GNAT family N-acetyltransferase -
OC617_RS15905 (CNRVC190243H_03138) 409093..409440 + 348 WP_000933409.1 hypothetical protein -
OC617_RS15910 409587..409880 + 294 WP_125460920.1 hypothetical protein -
OC617_RS15915 409943..410118 + 176 Protein_405 acetyltransferase -
OC617_RS15920 410179..410331 + 153 Protein_406 DUF645 family protein -
OC617_RS15925 (CNRVC190243H_03139) 410525..410842 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OC617_RS15930 (CNRVC190243H_03140) 410861..411103 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OC617_RS15935 (CNRVC190243H_03141) 411345..411854 + 510 WP_000405987.1 GNAT family N-acetyltransferase -
OC617_RS15940 (CNRVC190243H_03142) 411911..412564 + 654 WP_000226874.1 hypothetical protein -
OC617_RS15945 412653..412862 + 210 WP_001900246.1 DUF3709 domain-containing protein -
OC617_RS15950 412874..413092 + 219 WP_001917086.1 DUF3709 domain-containing protein -
OC617_RS15955 413281..413474 + 194 Protein_413 hypothetical protein -
OC617_RS15960 413495..413728 + 234 WP_032482776.1 DUF3709 domain-containing protein -
OC617_RS15965 414153..414333 + 181 Protein_415 DUF645 family protein -
OC617_RS15970 414446..414559 + 114 WP_001894955.1 hypothetical protein -
OC617_RS15975 (CNRVC190243H_03143) 414600..414887 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC617_RS15980 (CNRVC190243H_03144) 414898..415215 + 318 WP_001232701.1 HigA family addiction module antitoxin -
OC617_RS15985 415212..415322 + 111 WP_134814058.1 DUF3265 domain-containing protein -
OC617_RS15990 415361..415471 + 111 Protein_420 acetyltransferase -
OC617_RS15995 415499..415624 + 126 WP_001944767.1 DUF645 family protein -
OC617_RS16000 415587..415703 + 117 WP_001889170.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T295392 WP_001180243.1 NZ_OW443148:c410842-410525 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT295392 WP_000557292.1 NZ_OW443148:c411103-410861 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References