Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 995791..996369 | Replicon | chromosome |
Accession | NC_012667 | ||
Organism | Vibrio cholerae MJ-1236 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | VCD_RS19195 | Protein ID | WP_001180243.1 |
Coordinates | 996052..996369 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | VCD_RS19190 | Protein ID | WP_000557292.1 |
Coordinates | 995791..996033 (+) | Length | 81 a.a. |
Genomic Context
Location: 995791..996033 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Location: 996052..996369 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 991216..991254 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 991270..991395 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 991572..991682 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 991679..991996 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 992007..992294 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 992561..992741 (181 bp)
Type: Others
Protein ID: Protein_892
Type: Others
Protein ID: Protein_892
Location: 993166..993399 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 993802..994020 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 994330..994983 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 995040..995549 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 996563..996658 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 997014..997307 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 997454..997801 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 997950..998375 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 998571..998750 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 999047..999583 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 999727..1000122 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 1000299..1000480 (182 bp)
Type: Others
Protein ID: Protein_906
Type: Others
Protein ID: Protein_906
Location: 1000783..1001178 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCD_RS20895 | 991216..991254 | - | 39 | WP_106019119.1 | hypothetical protein | - |
VCD_RS20430 | 991270..991395 | - | 126 | WP_001944767.1 | DUF645 family protein | - |
VCD_RS21075 | 991572..991682 | - | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
VCD_RS19160 | 991679..991996 | - | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
VCD_RS19165 | 992007..992294 | - | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
VCD_RS19170 | 992561..992741 | - | 181 | Protein_892 | DUF645 family protein | - |
VCD_RS20440 | 993166..993399 | - | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
VCD_RS19175 | 993802..994020 | - | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
VCD_RS19180 | 994330..994983 | - | 654 | WP_000226874.1 | hypothetical protein | - |
VCD_RS19185 | 995040..995549 | - | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
VCD_RS19190 | 995791..996033 | + | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
VCD_RS19195 | 996052..996369 | + | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
VCD_RS21080 | 996563..996658 | - | 96 | WP_001907607.1 | DUF645 family protein | - |
VCD_RS20905 | 997014..997307 | - | 294 | WP_125460920.1 | hypothetical protein | - |
VCD_RS19200 | 997454..997801 | - | 348 | WP_000933409.1 | hypothetical protein | - |
VCD_RS19205 | 997950..998375 | - | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
VCD_RS19210 | 998571..998750 | - | 180 | WP_001883039.1 | DUF645 family protein | - |
VCD_RS19220 | 999047..999583 | - | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
VCD_RS19225 | 999727..1000122 | - | 396 | WP_000046953.1 | hypothetical protein | - |
VCD_RS20460 | 1000299..1000480 | - | 182 | Protein_906 | DUF645 family protein | - |
VCD_RS19230 | 1000783..1001178 | - | 396 | WP_000046952.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 932253..1057432 | 125179 | |
inside | Integron | - | - | 958376..1050596 | 92220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T23789 WP_001180243.1 NC_012667:996052-996369 [Vibrio cholerae MJ-1236]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T23789 NC_012667:996052-996369 [Vibrio cholerae MJ-1236]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT23789 WP_000557292.1 NC_012667:995791-996033 [Vibrio cholerae MJ-1236]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT23789 NC_012667:995791-996033 [Vibrio cholerae MJ-1236]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |