Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 336260..336758 | Replicon | chromosome |
Accession | NZ_CP028828 | ||
Organism | Vibrio cholerae strain N16961 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | N16961_RS15650 | Protein ID | WP_000589156.1 |
Coordinates | 336260..336526 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | N16961_RS15655 | Protein ID | WP_000643598.1 |
Coordinates | 336513..336758 (+) | Length | 82 a.a. |
Genomic Context
Location: 331681..331887 (207 bp)
Type: Others
Protein ID: Protein_294
Type: Others
Protein ID: Protein_294
Location: 332087..332188 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 332178..332564 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 332759..333010 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 332983..333132 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 333224..333466 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 333718..333996 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 334371..334514 (144 bp)
Type: Others
Protein ID: Protein_301
Type: Others
Protein ID: Protein_301
Location: 334568..334606 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 334818..335285 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 335413..336075 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 336260..336526 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 336513..336758 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 336854..337648 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 337751..337879 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 337940..338122 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 338338..339342 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 339495..339854 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 340127..340360 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 340628..341134 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 341291..341677 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N16961_RS15590 | 331681..331887 | + | 207 | Protein_294 | DUF3709 domain-containing protein | - |
N16961_RS15595 | 332087..332188 | + | 102 | WP_001921603.1 | hypothetical protein | - |
N16961_RS15600 | 332178..332564 | + | 387 | WP_000703163.1 | VOC family protein | - |
N16961_RS15605 | 332759..333010 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
N16961_RS15610 | 332983..333132 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
N16961_RS15615 | 333224..333466 | + | 243 | WP_000107461.1 | hypothetical protein | - |
N16961_RS15620 | 333718..333996 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
N16961_RS19805 | 334371..334514 | + | 144 | Protein_301 | DUF645 family protein | - |
N16961_RS19810 | 334568..334606 | + | 39 | WP_082798268.1 | hypothetical protein | - |
N16961_RS15635 | 334818..335285 | + | 468 | WP_001289288.1 | OsmC family protein | - |
N16961_RS15640 | 335413..336075 | + | 663 | WP_000960654.1 | hypothetical protein | - |
N16961_RS15650 | 336260..336526 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
N16961_RS15655 | 336513..336758 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
N16961_RS15660 | 336854..337648 | + | 795 | WP_001911581.1 | hypothetical protein | - |
N16961_RS19825 | 337751..337879 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
N16961_RS15675 | 337940..338122 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
N16961_RS15680 | 338338..339342 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
N16961_RS15685 | 339495..339854 | + | 360 | WP_001071541.1 | VOC family protein | - |
N16961_RS15690 | 340127..340360 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
N16961_RS15695 | 340628..341134 | + | 507 | WP_000393074.1 | hypothetical protein | - |
N16961_RS15700 | 341291..341677 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306977..438073 | 131096 | |
inside | Integron | - | - | 312057..437697 | 125640 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T104250 WP_000589156.1 NZ_CP028828:336260-336526 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T104250 NZ_CP028828:336260-336526 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT104250 WP_000643598.1 NZ_CP028828:336513-336758 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT104250 NZ_CP028828:336513-336758 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |