294357

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 933469..933997 Replicon chromosome
Accession NZ_LT992487
Organism Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)


Gene name relE Uniprot ID H9L4R3
Locus tag DG247_RS18695 Protein ID WP_000221352.1
Coordinates 933707..933997 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID H9L4T4
Locus tag DG247_RS18690 Protein ID WP_000213183.1
Coordinates 933469..933717 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG247_RS18640 928504..928968 + 465 WP_000140244.1 hypothetical protein -
DG247_RS18645 929068..929470 - 403 Protein_811 hypothetical protein -
DG247_RS18655 929626..930126 - 501 WP_000789723.1 hypothetical protein -
DG247_RS18660 930264..930794 - 531 WP_000415563.1 hypothetical protein -
DG247_RS18665 930945..931340 - 396 WP_000649527.1 DUF3465 domain-containing protein -
DG247_RS18670 931548..931973 - 426 WP_000415748.1 hypothetical protein -
DG247_RS18675 932245..932898 - 654 WP_000036957.1 site-specific DNA-methyltransferase -
DG247_RS18690 933469..933717 + 249 WP_000213183.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG247_RS18695 933707..933997 + 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG247_RS18700 934133..934648 - 516 WP_001201528.1 lipocalin family protein -
DG247_RS18705 934785..935261 - 477 WP_001047180.1 GNAT family N-acetyltransferase -
DG247_RS18710 935289..935399 - 111 WP_071917832.1 DUF3265 domain-containing protein -
DG247_RS18715 935396..936325 - 930 WP_000335802.1 hypothetical protein -
DG247_RS18720 936445..936891 - 447 WP_000128977.1 hypothetical protein -
DG247_RS18725 937044..938048 - 1005 WP_000964925.1 LD-carboxypeptidase -
DG247_RS19820 938261..938299 - 39 WP_106019119.1 hypothetical protein -
DG247_RS19825 938315..938440 - 126 WP_001944767.1 DUF645 family protein -
DG247_RS19830 938617..938727 - 111 WP_134814058.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 897525..994497 96972
inside Integron catB9 - 897901..987709 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11247.23 Da        Isoelectric Point: 10.4678

>T294357 WP_000221352.1 NZ_LT992487:933707-933997 [Vibrio cholerae]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8937.28 Da        Isoelectric Point: 4.1079

>AT294357 WP_000213183.1 NZ_LT992487:933469-933717 [Vibrio cholerae]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKERLSEDSVSVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H9L4R3

Antitoxin

Source ID Structure
AlphaFold DB A0A366A3W8

References