295402

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 453682..454241 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name relE Uniprot ID Q9K2M8
Locus tag OC617_RS16375 Protein ID WP_000578476.1
Coordinates 453682..453960 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9L991
Locus tag OC617_RS16380 Protein ID WP_000381183.1
Coordinates 453957..454241 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS16330 (CNRVC190243H_03196) 448982..449419 + 438 WP_000503169.1 IS200/IS605-like element IS1004 family transposase -
OC617_RS16335 (CNRVC190243H_03197) 449480..449701 + 222 Protein_489 GNAT family N-acetyltransferase -
OC617_RS16340 (CNRVC190243H_03198) 449876..450748 + 873 WP_000254716.1 DUF3800 domain-containing protein -
OC617_RS16345 (CNRVC190243H_03199) 450898..451497 + 600 WP_001891245.1 glutathione S-transferase N-terminal domain-containing protein -
OC617_RS16350 451554..451622 + 69 Protein_492 acetyltransferase -
OC617_RS16355 (CNRVC190243H_03200) 451689..451958 + 270 WP_001114075.1 DUF4160 domain-containing protein -
OC617_RS16360 (CNRVC190243H_03201) 451952..452473 + 522 WP_000921691.1 DUF2442 domain-containing protein -
OC617_RS16365 452772..452897 + 126 WP_001905700.1 DUF645 family protein -
OC617_RS16370 (CNRVC190243H_03202) 453148..453543 + 396 WP_001000867.1 hypothetical protein -
OC617_RS16375 (CNRVC190243H_03203) 453682..453960 - 279 WP_000578476.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
OC617_RS16380 (CNRVC190243H_03204) 453957..454241 - 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OC617_RS16385 (CNRVC190243H_03205) 454435..454950 + 516 WP_000343779.1 GNAT family protein -
OC617_RS16390 (CNRVC190243H_03206) 455134..455547 + 414 WP_000049420.1 VOC family protein -
OC617_RS16395 456102..457279 + 1178 WP_086010879.1 IS3-like element ISVch4 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049
flank IS/Tn - - 448982..449419 437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10819.59 Da        Isoelectric Point: 5.1651

>T295402 WP_000578476.1 NZ_OW443148:c453960-453682 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10901.25 Da        Isoelectric Point: 8.0775

>AT295402 WP_000381183.1 NZ_OW443148:c454241-453957 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9K2M8

Antitoxin

Source ID Structure
AlphaFold DB A0A067BL33

References