Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 334822..335320 | Replicon | chromosome |
Accession | NZ_CP028895 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | A1552VC_RS15875 | Protein ID | WP_000589156.1 |
Coordinates | 334822..335088 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | A1552VC_RS15880 | Protein ID | WP_000643598.1 |
Coordinates | 335075..335320 (+) | Length | 82 a.a. |
Genomic Context
Location: 330242..330448 (207 bp)
Type: Others
Protein ID: Protein_292
Type: Others
Protein ID: Protein_292
Location: 330648..330749 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 330739..331125 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 331320..331571 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 331544..331693 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 331785..332027 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 332279..332557 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 332932..333075 (144 bp)
Type: Others
Protein ID: Protein_299
Type: Others
Protein ID: Protein_299
Location: 333129..333167 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 333379..333846 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 333974..334637 (664 bp)
Type: Others
Protein ID: Protein_302
Type: Others
Protein ID: Protein_302
Location: 334822..335088 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 335075..335320 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 335416..336210 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 336313..336441 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 336502..336684 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 336900..337904 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 338057..338416 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 338689..338922 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 339190..339696 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 339853..340239 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A1552VC_RS15815 | 330242..330448 | + | 207 | Protein_292 | DUF3709 domain-containing protein | - |
A1552VC_RS15820 | 330648..330749 | + | 102 | WP_001921603.1 | hypothetical protein | - |
A1552VC_RS15825 | 330739..331125 | + | 387 | WP_000703163.1 | VOC family protein | - |
A1552VC_RS15830 | 331320..331571 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
A1552VC_RS15835 | 331544..331693 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
A1552VC_RS15840 | 331785..332027 | + | 243 | WP_000107461.1 | hypothetical protein | - |
A1552VC_RS15845 | 332279..332557 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
A1552VC_RS20015 | 332932..333075 | + | 144 | Protein_299 | DUF645 family protein | - |
A1552VC_RS20020 | 333129..333167 | + | 39 | WP_082798268.1 | hypothetical protein | - |
A1552VC_RS15860 | 333379..333846 | + | 468 | WP_001289288.1 | OsmC family protein | - |
A1552VC_RS15865 | 333974..334637 | + | 664 | Protein_302 | hypothetical protein | - |
A1552VC_RS15875 | 334822..335088 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
A1552VC_RS15880 | 335075..335320 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
A1552VC_RS15885 | 335416..336210 | + | 795 | WP_001911581.1 | hypothetical protein | - |
A1552VC_RS20035 | 336313..336441 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
A1552VC_RS15900 | 336502..336684 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
A1552VC_RS15905 | 336900..337904 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
A1552VC_RS15910 | 338057..338416 | + | 360 | WP_001071541.1 | VOC family protein | - |
A1552VC_RS15915 | 338689..338922 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
A1552VC_RS15920 | 339190..339696 | + | 507 | WP_000393074.1 | hypothetical protein | - |
A1552VC_RS15925 | 339853..340239 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306914..436175 | 129261 | |
inside | Integron | - | - | 311994..435799 | 123805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T104338 WP_000589156.1 NZ_CP028895:334822-335088 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T104338 NZ_CP028895:334822-335088 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT104338 WP_000643598.1 NZ_CP028895:335075-335320 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT104338 NZ_CP028895:335075-335320 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |