Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 333863..334361 | Replicon | chromosome |
Accession | NZ_CP006948 | ||
Organism | Vibrio cholerae O1 str. KW3 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | N900_RS15555 | Protein ID | WP_000589156.1 |
Coordinates | 333863..334129 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | N900_RS15560 | Protein ID | WP_000643598.1 |
Coordinates | 334116..334361 (+) | Length | 82 a.a. |
Genomic Context
Location: 329285..329491 (207 bp)
Type: Others
Protein ID: Protein_291
Type: Others
Protein ID: Protein_291
Location: 329691..329792 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 329782..330168 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 330363..330614 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 330587..330736 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 330828..331070 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 331214..331599 (386 bp)
Type: Others
Protein ID: Protein_297
Type: Others
Protein ID: Protein_297
Location: 331974..332117 (144 bp)
Type: Others
Protein ID: Protein_298
Type: Others
Protein ID: Protein_298
Location: 332171..332209 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 332421..332888 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 333016..333678 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 333863..334129 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 334116..334361 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 334457..335251 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 335542..335724 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 335938..336942 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 337095..337454 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 337727..337960 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 338228..338734 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 338891..339277 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N900_RS19930 | 329285..329491 | + | 207 | Protein_291 | DUF3709 domain-containing protein | - |
N900_RS19935 | 329691..329792 | + | 102 | WP_001921603.1 | hypothetical protein | - |
N900_RS15525 | 329782..330168 | + | 387 | WP_000703163.1 | VOC family protein | - |
N900_RS15530 | 330363..330614 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
N900_RS19445 | 330587..330736 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
N900_RS15535 | 330828..331070 | + | 243 | WP_000107461.1 | hypothetical protein | - |
N900_RS19450 | 331214..331599 | + | 386 | Protein_297 | DUF3709 domain-containing protein | - |
N900_RS20340 | 331974..332117 | + | 144 | Protein_298 | DUF645 family protein | - |
N900_RS20345 | 332171..332209 | + | 39 | WP_082798268.1 | hypothetical protein | - |
N900_RS15545 | 332421..332888 | + | 468 | WP_001289288.1 | OsmC family protein | - |
N900_RS15550 | 333016..333678 | + | 663 | WP_000960654.1 | hypothetical protein | - |
N900_RS15555 | 333863..334129 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
N900_RS15560 | 334116..334361 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
N900_RS15565 | 334457..335251 | + | 795 | WP_001911581.1 | hypothetical protein | - |
N900_RS15570 | 335542..335724 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
N900_RS15575 | 335938..336942 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
N900_RS15580 | 337095..337454 | + | 360 | WP_001071541.1 | VOC family protein | - |
N900_RS15585 | 337727..337960 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
N900_RS15590 | 338228..338734 | + | 507 | WP_000393074.1 | hypothetical protein | - |
N900_RS15595 | 338891..339277 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304645..411088 | 106443 | |
inside | Integron | - | - | 309725..410760 | 101035 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T45805 WP_000589156.1 NZ_CP006948:333863-334129 [Vibrio cholerae O1 str. KW3]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T45805 NZ_CP006948:333863-334129 [Vibrio cholerae O1 str. KW3]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT45805 WP_000643598.1 NZ_CP006948:334116-334361 [Vibrio cholerae O1 str. KW3]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT45805 NZ_CP006948:334116-334361 [Vibrio cholerae O1 str. KW3]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |