Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
Location | 422119..422918 | Replicon | chromosome |
Accession | NZ_CP047306 | ||
Organism | Vibrio cholerae O37 strain ATCC 25872 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KM94 |
Locus tag | GTH07_RS15610 | Protein ID | WP_000118351.1 |
Coordinates | 422385..422918 (+) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A0K9UER4 |
Locus tag | GTH07_RS18740 | Protein ID | WP_000179600.1 |
Coordinates | 422119..422388 (+) | Length | 90 a.a. |
Genomic Context
Location: 417492..417743 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 417733..418020 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 418148..418603 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 418660..418782 (123 bp)
Type: Others
Protein ID: Protein_464
Type: Others
Protein ID: Protein_464
Location: 418953..419077 (125 bp)
Type: Others
Protein ID: Protein_465
Type: Others
Protein ID: Protein_465
Location: 420198..420260 (63 bp)
Type: Others
Protein ID: Protein_468
Type: Others
Protein ID: Protein_468
Location: 420277..420945 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 421097..421384 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 421525..421896 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 422119..422388 (270 bp)
Type: Antitoxin
Protein ID: WP_000179600.1
Type: Antitoxin
Protein ID: WP_000179600.1
Location: 422385..422918 (534 bp)
Type: Toxin
Protein ID: WP_000118351.1
Type: Toxin
Protein ID: WP_000118351.1
Location: 422928..423038 (111 bp)
Type: Others
Protein ID: WP_086010065.1
Type: Others
Protein ID: WP_086010065.1
Location: 423120..423377 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 423365..423667 (303 bp)
Type: Others
Protein ID: WP_000229317.1
Type: Others
Protein ID: WP_000229317.1
Location: 423901..424818 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 425026..425268 (243 bp)
Type: Others
Protein ID: WP_000107462.1
Type: Others
Protein ID: WP_000107462.1
Location: 425443..425832 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 425968..426177 (210 bp)
Type: Others
Protein ID: Protein_480
Type: Others
Protein ID: Protein_480
Location: 426296..426733 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 426794..427015 (222 bp)
Type: Others
Protein ID: Protein_482
Type: Others
Protein ID: Protein_482
Location: 419280..419777 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 419774..420046 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTH07_RS15560 (GTH07_15635) | 417492..417743 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTH07_RS15565 (GTH07_15640) | 417733..418020 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GTH07_RS15570 (GTH07_15645) | 418148..418603 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
GTH07_RS18730 | 418660..418782 | + | 123 | Protein_464 | acetyltransferase | - |
GTH07_RS15575 (GTH07_15650) | 418953..419077 | + | 125 | Protein_465 | DUF645 family protein | - |
GTH07_RS15580 (GTH07_15655) | 419280..419777 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
GTH07_RS15585 (GTH07_15660) | 419774..420046 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
GTH07_RS18735 | 420198..420260 | + | 63 | Protein_468 | acetyltransferase | - |
GTH07_RS15590 (GTH07_15665) | 420277..420945 | + | 669 | WP_000043871.1 | hypothetical protein | - |
GTH07_RS15595 (GTH07_15670) | 421097..421384 | + | 288 | WP_000426470.1 | hypothetical protein | - |
GTH07_RS15600 (GTH07_15675) | 421525..421896 | + | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
GTH07_RS18740 (GTH07_15680) | 422119..422388 | + | 270 | WP_000179600.1 | DUF1778 domain-containing protein | Antitoxin |
GTH07_RS15610 (GTH07_15685) | 422385..422918 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | Toxin |
GTH07_RS18745 (GTH07_15690) | 422928..423038 | + | 111 | WP_086010065.1 | DUF3265 domain-containing protein | - |
GTH07_RS15615 (GTH07_15695) | 423120..423377 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTH07_RS15620 (GTH07_15700) | 423365..423667 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GTH07_RS15625 (GTH07_15705) | 423901..424818 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
GTH07_RS15630 (GTH07_15710) | 425026..425268 | + | 243 | WP_000107462.1 | hypothetical protein | - |
GTH07_RS15635 (GTH07_15715) | 425443..425832 | + | 390 | WP_001081302.1 | hypothetical protein | - |
GTH07_RS15640 (GTH07_15720) | 425968..426177 | + | 210 | Protein_480 | GNAT family N-acetyltransferase | - |
GTH07_RS15645 (GTH07_15725) | 426296..426733 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
GTH07_RS15650 (GTH07_15730) | 426794..427015 | + | 222 | Protein_482 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 307620..433724 | 126104 | |
- | inside | Integron | - | - | 312700..433348 | 120648 | |
flank | IS/Tn | - | - | 426296..426733 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 20171.46 Da Isoelectric Point: 9.1432
>T145915 WP_000118351.1 NZ_CP047306:422385-422918 [Vibrio cholerae O37]
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ
Download Length: 534 bp
>T145915 NZ_CP062708:c4713316-4713002 [Escherichia coli O157:H7]
ATGCAATTTACGGTATACCGCAGTCGCAGTAGGAACGCCGCGTTTCCCTTTGTTATCGATGTTACCAGCGACATTATTGG
TGTGATTAATCGCCGTATTGTTATTCCATTAACACCTATTGAACGATTTAGCCGTATTCGCCCACCAGAACGGCTTAACC
CAATCCTTTTACTGGTAGACGGCAAAGAATATGTGCTCATGACGCATGAGACTGCAACTGTTCCAGTTAACGCGCTGGGA
ACGAAATTTTGCGATGCCAGCGCGCACCGAACGTTGATTAAAGGAGCATTAGATTTTATGCTCGACGGGATTTAA
ATGCAATTTACGGTATACCGCAGTCGCAGTAGGAACGCCGCGTTTCCCTTTGTTATCGATGTTACCAGCGACATTATTGG
TGTGATTAATCGCCGTATTGTTATTCCATTAACACCTATTGAACGATTTAGCCGTATTCGCCCACCAGAACGGCTTAACC
CAATCCTTTTACTGGTAGACGGCAAAGAATATGTGCTCATGACGCATGAGACTGCAACTGTTCCAGTTAACGCGCTGGGA
ACGAAATTTTGCGATGCCAGCGCGCACCGAACGTTGATTAAAGGAGCATTAGATTTTATGCTCGACGGGATTTAA
Antitoxin
Download Length: 90 a.a. Molecular weight: 9924.49 Da Isoelectric Point: 4.9107
>AT145915 WP_000179600.1 NZ_CP047306:422119-422388 [Vibrio cholerae O37]
MATARLDIRLDEEIKAKAEKASALLGLKSLTEYVVRLMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAV
KFTEKSGIK
MATARLDIRLDEEIKAKAEKASALLGLKSLTEYVVRLMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAV
KFTEKSGIK
Download Length: 270 bp
>AT145915 NZ_CP062708:c4713552-4713319 [Escherichia coli O157:H7]
ATGACTGCAAAACGTACCACACAAAGTGTGACCGTCACCGTCGACCGTGAGTTAGTCAATCGCGCTCGTGATGCAGGCTT
AAATATGAGCGCCACCCTTACGGTTGCGCTCAATGCTGAACTTAAAAAACATGCAGCAACACGTTGGCGTGAAGAGAACG
CTGAAGCTATCGCTGCGTTAAATCAATTGGCTGATGAAACCGGATGTTTCTCTGATGAGTACCGGAGCTTCTAG
ATGACTGCAAAACGTACCACACAAAGTGTGACCGTCACCGTCGACCGTGAGTTAGTCAATCGCGCTCGTGATGCAGGCTT
AAATATGAGCGCCACCCTTACGGTTGCGCTCAATGCTGAACTTAAAAAACATGCAGCAACACGTTGGCGTGAAGAGAACG
CTGAAGCTATCGCTGCGTTAAATCAATTGGCTGATGAAACCGGATGTTTCTCTGATGAGTACCGGAGCTTCTAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM94 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UER4 |