Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 459604..460008 | Replicon | chromosome II |
Accession | NC_012583 | ||
Organism | Vibrio cholerae O395 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | VC395_RS16685 | Protein ID | WP_001114075.1 |
Coordinates | 459739..460008 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | VC395_RS20935 | Protein ID | WP_099607150.1 |
Coordinates | 459604..459708 (+) | Length | 35 a.a. |
Genomic Context
Location: 454637..455554 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 455762..456004 (243 bp)
Type: Others
Protein ID: WP_000107462.1
Type: Others
Protein ID: WP_000107462.1
Location: 456179..456568 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 456704..456913 (210 bp)
Type: Others
Protein ID: Protein_484
Type: Others
Protein ID: Protein_484
Location: 457032..457469 (438 bp)
Type: Others
Protein ID: WP_000503164.1
Type: Others
Protein ID: WP_000503164.1
Location: 457533..457751 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 457926..458798 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 458948..459547 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 459604..459708 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 459739..460008 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 460002..460523 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 460822..460947 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 461198..461593 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 462485..463000 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 463184..463597 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 461732..462010 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 462007..462291 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VC395_RS16645 | 454637..455554 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
VC395_RS16650 | 455762..456004 | + | 243 | WP_000107462.1 | hypothetical protein | - |
VC395_RS16655 | 456179..456568 | + | 390 | WP_001081302.1 | hypothetical protein | - |
VC395_RS16660 | 456704..456913 | + | 210 | Protein_484 | GNAT family N-acetyltransferase | - |
VC395_RS16665 | 457032..457469 | + | 438 | WP_000503164.1 | IS200/IS605-like element IS1004 family transposase | - |
VC395_RS16670 | 457533..457751 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
VC395_RS16675 | 457926..458798 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
VC395_RS16680 | 458948..459547 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
VC395_RS20935 | 459604..459708 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
VC395_RS16685 | 459739..460008 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
VC395_RS16690 | 460002..460523 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
VC395_RS20685 | 460822..460947 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
VC395_RS16705 | 461198..461593 | + | 396 | WP_001000867.1 | hypothetical protein | - |
VC395_RS16710 | 461732..462010 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
VC395_RS16715 | 462007..462291 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
VC395_RS16720 | 462485..463000 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
VC395_RS16725 | 463184..463597 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 427343..471178 | 43835 | |
- | inside | Integron | - | - | 450510..464084 | 13574 | |
flank | IS/Tn | - | - | 457032..457469 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T23738 WP_001114075.1 NC_012583:459739-460008 [Vibrio cholerae O395]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T23738 NC_012583:459739-460008 [Vibrio cholerae O395]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT23738 WP_099607150.1 NC_012583:459604-459708 [Vibrio cholerae O395]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT23738 NC_012583:459604-459708 [Vibrio cholerae O395]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |