Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 803934..804338 | Replicon | chromosome |
Accession | NC_009456 | ||
Organism | Vibrio cholerae O395 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | VC0395_RS03595 | Protein ID | WP_001114075.1 |
Coordinates | 803934..804203 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | VC0395_RS20695 | Protein ID | WP_099607150.1 |
Coordinates | 804234..804338 (-) | Length | 35 a.a. |
Genomic Context
Location: 801651..801935 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Location: 801932..802210 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 800345..800758 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 800942..801457 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 802349..802744 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 802995..803120 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 803419..803940 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 803934..804203 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 804234..804338 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 804395..804994 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 805144..806016 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 806191..806409 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 806473..806910 (438 bp)
Type: Others
Protein ID: WP_000503164.1
Type: Others
Protein ID: WP_000503164.1
Location: 807029..807238 (210 bp)
Type: Others
Protein ID: Protein_694
Type: Others
Protein ID: Protein_694
Location: 807374..807763 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 807938..808180 (243 bp)
Type: Others
Protein ID: WP_000107462.1
Type: Others
Protein ID: WP_000107462.1
Location: 808388..809305 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VC0395_RS03555 | 800345..800758 | - | 414 | WP_000049420.1 | VOC family protein | - |
VC0395_RS03560 | 800942..801457 | - | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
VC0395_RS03565 | 801651..801935 | + | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
VC0395_RS03570 | 801932..802210 | + | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
VC0395_RS03575 | 802349..802744 | - | 396 | WP_001000867.1 | hypothetical protein | - |
VC0395_RS20505 | 802995..803120 | - | 126 | WP_001905700.1 | DUF645 family protein | - |
VC0395_RS03590 | 803419..803940 | - | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
VC0395_RS03595 | 803934..804203 | - | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
VC0395_RS20695 | 804234..804338 | - | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
VC0395_RS03600 | 804395..804994 | - | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
VC0395_RS03605 | 805144..806016 | - | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
VC0395_RS03610 | 806191..806409 | - | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
VC0395_RS03615 | 806473..806910 | - | 438 | WP_000503164.1 | IS200/IS605-like element IS1004 family transposase | - |
VC0395_RS03620 | 807029..807238 | - | 210 | Protein_694 | GNAT family N-acetyltransferase | - |
VC0395_RS03625 | 807374..807763 | - | 390 | WP_001081302.1 | hypothetical protein | - |
VC0395_RS03630 | 807938..808180 | - | 243 | WP_000107462.1 | hypothetical protein | - |
VC0395_RS03635 | 808388..809305 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 782136..816693 | 34557 | |
- | inside | Integron | - | - | 799858..813432 | 13574 | |
flank | IS/Tn | - | - | 806473..806910 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T22071 WP_001114075.1 NC_009456:c804203-803934 [Vibrio cholerae O395]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T22071 NC_009456:c804203-803934 [Vibrio cholerae O395]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT22071 WP_099607150.1 NC_009456:c804338-804234 [Vibrio cholerae O395]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT22071 NC_009456:c804338-804234 [Vibrio cholerae O395]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |