Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 404922..405326 | Replicon | chromosome II |
Accession | NC_012580 | ||
Organism | Vibrio cholerae M66-2 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | VCM66_RS15420 | Protein ID | WP_001114075.1 |
Coordinates | 405057..405326 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | VCM66_RS19440 | Protein ID | WP_099607150.1 |
Coordinates | 404922..405026 (+) | Length | 35 a.a. |
Genomic Context
Location: 400164..400589 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 400586..401119 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 401321..401578 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 401566..401868 (303 bp)
Type: Others
Protein ID: WP_000229317.1
Type: Others
Protein ID: WP_000229317.1
Location: 402022..402231 (210 bp)
Type: Others
Protein ID: Protein_419
Type: Others
Protein ID: Protein_419
Location: 402350..402787 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 402851..403069 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 403244..404116 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 404266..404865 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 404922..405026 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 405057..405326 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 405320..405841 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 406140..406265 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 406516..406911 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 407803..408318 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 408502..408915 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 407050..407328 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 407325..407609 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCM66_RS19595 | 400164..400589 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
VCM66_RS15380 | 400586..401119 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
VCM66_RS15385 | 401321..401578 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
VCM66_RS15390 | 401566..401868 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
VCM66_RS15395 | 402022..402231 | + | 210 | Protein_419 | GNAT family N-acetyltransferase | - |
VCM66_RS15400 | 402350..402787 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
VCM66_RS15405 | 402851..403069 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
VCM66_RS15410 | 403244..404116 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
VCM66_RS15415 | 404266..404865 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
VCM66_RS19440 | 404922..405026 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
VCM66_RS15420 | 405057..405326 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
VCM66_RS15425 | 405320..405841 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
VCM66_RS19445 | 406140..406265 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
VCM66_RS15430 | 406516..406911 | + | 396 | WP_001000867.1 | hypothetical protein | - |
VCM66_RS15435 | 407050..407328 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
VCM66_RS15440 | 407325..407609 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
VCM66_RS15445 | 407803..408318 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
VCM66_RS15450 | 408502..408915 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 305869..409778 | 103909 | |
- | inside | Integron | - | - | 310949..409402 | 98453 | |
flank | IS/Tn | - | - | 402350..402787 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T23719 WP_001114075.1 NC_012580:405057-405326 [Vibrio cholerae M66-2]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T23719 NC_012580:405057-405326 [Vibrio cholerae M66-2]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT23719 WP_099607150.1 NC_012580:404922-405026 [Vibrio cholerae M66-2]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT23719 NC_012580:404922-405026 [Vibrio cholerae M66-2]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |