Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 833775..834179 | Replicon | chromosome |
Accession | NZ_CP013013 | ||
Organism | Vibrio cholerae strain Env-390 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | AP033_RS03750 | Protein ID | WP_001114075.1 |
Coordinates | 833775..834044 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | AP033_RS19775 | Protein ID | WP_099607150.1 |
Coordinates | 834075..834179 (-) | Length | 35 a.a. |
Genomic Context
Location: 831492..831776 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Location: 831773..832051 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 830186..830599 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 830783..831298 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 832190..832585 (396 bp)
Type: Others
Protein ID: WP_001000868.1
Type: Others
Protein ID: WP_001000868.1
Location: 832836..832961 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 833260..833781 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 833775..834044 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 834075..834179 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 834236..834835 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 834985..835857 (873 bp)
Type: Others
Protein ID: WP_000254717.1
Type: Others
Protein ID: WP_000254717.1
Location: 836032..836250 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 836314..836751 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 836870..837079 (210 bp)
Type: Others
Protein ID: Protein_732
Type: Others
Protein ID: Protein_732
Location: 837215..837604 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 837779..838021 (243 bp)
Type: Others
Protein ID: WP_000107462.1
Type: Others
Protein ID: WP_000107462.1
Location: 838229..839146 (918 bp)
Type: Others
Protein ID: WP_033935911.1
Type: Others
Protein ID: WP_033935911.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AP033_RS03720 | 830186..830599 | - | 414 | WP_000049420.1 | VOC family protein | - |
AP033_RS03725 | 830783..831298 | - | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
AP033_RS03730 | 831492..831776 | + | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
AP033_RS03735 | 831773..832051 | + | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
AP033_RS03740 | 832190..832585 | - | 396 | WP_001000868.1 | hypothetical protein | - |
AP033_RS19770 | 832836..832961 | - | 126 | WP_001905700.1 | DUF645 family protein | - |
AP033_RS03745 | 833260..833781 | - | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
AP033_RS03750 | 833775..834044 | - | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
AP033_RS19775 | 834075..834179 | - | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
AP033_RS03755 | 834236..834835 | - | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
AP033_RS03760 | 834985..835857 | - | 873 | WP_000254717.1 | DUF3800 domain-containing protein | - |
AP033_RS03765 | 836032..836250 | - | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
AP033_RS03770 | 836314..836751 | - | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
AP033_RS03775 | 836870..837079 | - | 210 | Protein_732 | GNAT family N-acetyltransferase | - |
AP033_RS03780 | 837215..837604 | - | 390 | WP_001081302.1 | hypothetical protein | - |
AP033_RS03785 | 837779..838021 | - | 243 | WP_000107462.1 | hypothetical protein | - |
AP033_RS03790 | 838229..839146 | - | 918 | WP_033935911.1 | alpha/beta hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 836314..836751 | 437 | ||
- | inside | Integron | - | - | 829699..942463 | 112764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T57702 WP_001114075.1 NZ_CP013013:c834044-833775 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T57702 NZ_CP013013:c834044-833775 [Vibrio cholerae]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT57702 WP_099607150.1 NZ_CP013013:c834179-834075 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT57702 NZ_CP013013:c834179-834075 [Vibrio cholerae]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |