Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
Location | 809837..810792 | Replicon | chromosome |
Accession | NZ_CP045718 | ||
Organism | Vibrio cholerae O395 substr. TCP2 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KM94 |
Locus tag | GG844_RS03620 | Protein ID | WP_000118351.1 |
Coordinates | 809837..810370 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | GG844_RS19640 | Protein ID | WP_001882332.1 |
Coordinates | 810367..810792 (-) | Length | 142 a.a. |
Genomic Context
Location: 812709..812981 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 812978..813475 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 813772..814266 (495 bp)
Type: Others
Protein ID: WP_000477435.1
Type: Others
Protein ID: WP_000477435.1
Location: 805740..805958 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 806022..806459 (438 bp)
Type: Others
Protein ID: WP_000503164.1
Type: Others
Protein ID: WP_000503164.1
Location: 806578..806787 (210 bp)
Type: Others
Protein ID: Protein_694
Type: Others
Protein ID: Protein_694
Location: 806923..807312 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 807487..807729 (243 bp)
Type: Others
Protein ID: WP_000107462.1
Type: Others
Protein ID: WP_000107462.1
Location: 807937..808854 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 809088..809390 (303 bp)
Type: Others
Protein ID: WP_000229317.1
Type: Others
Protein ID: WP_000229317.1
Location: 809378..809635 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 809837..810370 (534 bp)
Type: Toxin
Protein ID: WP_000118351.1
Type: Toxin
Protein ID: WP_000118351.1
Location: 810367..810792 (426 bp)
Type: Antitoxin
Protein ID: WP_001882332.1
Type: Antitoxin
Protein ID: WP_001882332.1
Location: 810859..811230 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 811371..811658 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 811810..812478 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GG844_RS03575 | 805740..805958 | - | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
GG844_RS03580 | 806022..806459 | - | 438 | WP_000503164.1 | IS200/IS605-like element IS1004 family transposase | - |
GG844_RS03585 | 806578..806787 | - | 210 | Protein_694 | GNAT family N-acetyltransferase | - |
GG844_RS03590 | 806923..807312 | - | 390 | WP_001081302.1 | hypothetical protein | - |
GG844_RS03595 | 807487..807729 | - | 243 | WP_000107462.1 | hypothetical protein | - |
GG844_RS03600 | 807937..808854 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
GG844_RS03605 | 809088..809390 | - | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GG844_RS03610 | 809378..809635 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GG844_RS03620 | 809837..810370 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | Toxin |
GG844_RS19640 | 810367..810792 | - | 426 | WP_001882332.1 | DUF1778 domain-containing protein | Antitoxin |
GG844_RS03630 | 810859..811230 | - | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
GG844_RS03635 | 811371..811658 | - | 288 | WP_000426470.1 | hypothetical protein | - |
GG844_RS03640 | 811810..812478 | - | 669 | WP_000043871.1 | hypothetical protein | - |
GG844_RS03645 | 812709..812981 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
GG844_RS03650 | 812978..813475 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
GG844_RS03655 | 813772..814266 | + | 495 | WP_000477435.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 791552..816242 | 24690 | |
- | inside | Integron | - | - | 799407..812981 | 13574 | |
flank | IS/Tn | - | - | 806022..806459 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 20171.46 Da Isoelectric Point: 9.1432
>T142371 WP_000118351.1 NZ_CP045718:c810370-809837 [Vibrio cholerae O395]
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ
Download Length: 534 bp
>T142371 NZ_CP060672:2431314-2431469 [Salmonella enterica]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 142 a.a. Molecular weight: 15714.41 Da Isoelectric Point: 7.6659
>AT142371 WP_001882332.1 NZ_CP045718:c810792-810367 [Vibrio cholerae O395]
MLCLSLVVMRCQPLRRALYSPSPRKLSVRIECALSLAYNRSTDGMYPYAGGVMATARLDIRLDEEIKAKAEKASALLGLK
SLTEYVVRLMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAVKFTEKSGIK
MLCLSLVVMRCQPLRRALYSPSPRKLSVRIECALSLAYNRSTDGMYPYAGGVMATARLDIRLDEEIKAKAEKASALLGLK
SLTEYVVRLMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAVKFTEKSGIK
Download Length: 426 bp
>AT142371 NZ_CP060672:c2431302-2431244 [Salmonella enterica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM94 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |