Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 838678..839082 | Replicon | chromosome |
Accession | NZ_CP013312 | ||
Organism | Vibrio cholerae strain E1320 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | ASZ88_RS18570 | Protein ID | WP_001114075.1 |
Coordinates | 838813..839082 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | ASZ88_RS20900 | Protein ID | WP_099607150.1 |
Coordinates | 838678..838782 (+) | Length | 35 a.a. |
Genomic Context
Location: 834179..835096 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 835253..835642 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 835778..835987 (210 bp)
Type: Others
Protein ID: Protein_855
Type: Others
Protein ID: Protein_855
Location: 836106..836543 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 836607..836825 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 837000..837872 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 838022..838621 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 838678..838782 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 838813..839082 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 839076..839597 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 839896..840021 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 840272..840667 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 841559..842074 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 842258..842671 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 840806..841084 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 841081..841365 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ88_RS18525 | 834179..835096 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
ASZ88_RS18535 | 835253..835642 | + | 390 | WP_001081302.1 | hypothetical protein | - |
ASZ88_RS18540 | 835778..835987 | + | 210 | Protein_855 | GNAT family N-acetyltransferase | - |
ASZ88_RS18545 | 836106..836543 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
ASZ88_RS18550 | 836607..836825 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
ASZ88_RS18560 | 837000..837872 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
ASZ88_RS18565 | 838022..838621 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
ASZ88_RS20900 | 838678..838782 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
ASZ88_RS18570 | 838813..839082 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
ASZ88_RS18575 | 839076..839597 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
ASZ88_RS20905 | 839896..840021 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
ASZ88_RS18590 | 840272..840667 | + | 396 | WP_001000867.1 | hypothetical protein | - |
ASZ88_RS18595 | 840806..841084 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
ASZ88_RS18600 | 841081..841365 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
ASZ88_RS18605 | 841559..842074 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
ASZ88_RS18610 | 842258..842671 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 688711..843534 | 154823 | |
- | inside | Integron | catB9 | - | 693791..843158 | 149367 | |
flank | IS/Tn | - | - | 836106..836543 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T58344 WP_001114075.1 NZ_CP013312:838813-839082 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T58344 NZ_CP013312:838813-839082 [Vibrio cholerae]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT58344 WP_099607150.1 NZ_CP013312:838678-838782 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT58344 NZ_CP013312:838678-838782 [Vibrio cholerae]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |