Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 832570..832974 | Replicon | chromosome |
Accession | NZ_CP042300 | ||
Organism | Vibrio cholerae O1 strain AAS91 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | FKV26_RS17075 | Protein ID | WP_001114075.1 |
Coordinates | 832570..832839 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | FKV26_RS17080 | Protein ID | WP_099607150.1 |
Coordinates | 832870..832974 (-) | Length | 35 a.a. |
Genomic Context
Location: 830287..830571 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Location: 830568..830846 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 828981..829394 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 829578..830093 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 830985..831380 (396 bp)
Type: Others
Protein ID: WP_001000868.1
Type: Others
Protein ID: WP_001000868.1
Location: 831631..831756 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 832055..832576 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 832570..832839 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 832870..832974 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 833031..833630 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 833780..834652 (873 bp)
Type: Others
Protein ID: WP_000254717.1
Type: Others
Protein ID: WP_000254717.1
Location: 834827..835045 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 835109..835546 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 835665..835874 (210 bp)
Type: Others
Protein ID: Protein_729
Type: Others
Protein ID: Protein_729
Location: 836010..836399 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 836574..836816 (243 bp)
Type: Others
Protein ID: WP_000107462.1
Type: Others
Protein ID: WP_000107462.1
Location: 837024..837941 (918 bp)
Type: Others
Protein ID: WP_033935911.1
Type: Others
Protein ID: WP_033935911.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FKV26_RS17040 | 828981..829394 | - | 414 | WP_000049420.1 | VOC family protein | - |
FKV26_RS17045 | 829578..830093 | - | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
FKV26_RS17050 | 830287..830571 | + | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
FKV26_RS17055 | 830568..830846 | + | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
FKV26_RS17060 | 830985..831380 | - | 396 | WP_001000868.1 | hypothetical protein | - |
FKV26_RS17065 | 831631..831756 | - | 126 | WP_001905700.1 | DUF645 family protein | - |
FKV26_RS17070 | 832055..832576 | - | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
FKV26_RS17075 | 832570..832839 | - | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
FKV26_RS17080 | 832870..832974 | - | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
FKV26_RS17085 | 833031..833630 | - | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
FKV26_RS17090 | 833780..834652 | - | 873 | WP_000254717.1 | DUF3800 domain-containing protein | - |
FKV26_RS17095 | 834827..835045 | - | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
FKV26_RS17100 | 835109..835546 | - | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
FKV26_RS17105 | 835665..835874 | - | 210 | Protein_729 | GNAT family N-acetyltransferase | - |
FKV26_RS17110 | 836010..836399 | - | 390 | WP_001081302.1 | hypothetical protein | - |
FKV26_RS17115 | 836574..836816 | - | 243 | WP_000107462.1 | hypothetical protein | - |
FKV26_RS17120 | 837024..837941 | - | 918 | WP_033935911.1 | alpha/beta hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 827249..947639 | 120390 | |
flank | IS/Tn | - | - | 835109..835546 | 437 | ||
- | inside | Integron | - | - | 828494..941258 | 112764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T135194 WP_001114075.1 NZ_CP042300:c832839-832570 [Vibrio cholerae O1]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T135194 NZ_CP042300:c832839-832570 [Vibrio cholerae O1]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT135194 WP_099607150.1 NZ_CP042300:c832974-832870 [Vibrio cholerae O1]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT135194 NZ_CP042300:c832974-832870 [Vibrio cholerae O1]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |