Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 401321..401868 | Replicon | chromosome II |
Accession | NC_012580 | ||
Organism | Vibrio cholerae M66-2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | VCM66_RS15390 | Protein ID | WP_000229317.1 |
Coordinates | 401566..401868 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | VCM66_RS15385 | Protein ID | WP_000861987.1 |
Coordinates | 401321..401578 (+) | Length | 86 a.a. |
Genomic Context
Location: 396350..396805 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 397127..397279 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 398478..399146 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 399298..399585 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 399726..400097 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 400164..400589 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 400586..401119 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 401321..401578 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 401566..401868 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 402022..402231 (210 bp)
Type: Others
Protein ID: Protein_419
Type: Others
Protein ID: Protein_419
Location: 402350..402787 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 402851..403069 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 403244..404116 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 404266..404865 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 404922..405026 (105 bp)
Type: Others
Protein ID: WP_099607150.1
Type: Others
Protein ID: WP_099607150.1
Location: 405057..405326 (270 bp)
Type: Others
Protein ID: WP_001114075.1
Type: Others
Protein ID: WP_001114075.1
Location: 405320..405841 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 406140..406265 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 397481..397978 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 397975..398247 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCM66_RS15345 | 396350..396805 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
VCM66_RS19005 | 397127..397279 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
VCM66_RS15350 | 397481..397978 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
VCM66_RS15355 | 397975..398247 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
VCM66_RS15360 | 398478..399146 | + | 669 | WP_000043871.1 | hypothetical protein | - |
VCM66_RS15365 | 399298..399585 | + | 288 | WP_000426470.1 | hypothetical protein | - |
VCM66_RS15370 | 399726..400097 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
VCM66_RS19595 | 400164..400589 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
VCM66_RS15380 | 400586..401119 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
VCM66_RS15385 | 401321..401578 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
VCM66_RS15390 | 401566..401868 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
VCM66_RS15395 | 402022..402231 | + | 210 | Protein_419 | GNAT family N-acetyltransferase | - |
VCM66_RS15400 | 402350..402787 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
VCM66_RS15405 | 402851..403069 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
VCM66_RS15410 | 403244..404116 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
VCM66_RS15415 | 404266..404865 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
VCM66_RS19440 | 404922..405026 | + | 105 | WP_099607150.1 | acetyltransferase | - |
VCM66_RS15420 | 405057..405326 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | - |
VCM66_RS15425 | 405320..405841 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
VCM66_RS19445 | 406140..406265 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 305869..409778 | 103909 | |
- | inside | Integron | - | - | 310949..409402 | 98453 | |
flank | IS/Tn | - | - | 402350..402787 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T23718 WP_000229317.1 NC_012580:401566-401868 [Vibrio cholerae M66-2]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T23718 NC_012580:401566-401868 [Vibrio cholerae M66-2]
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT23718 WP_000861987.1 NC_012580:401321-401578 [Vibrio cholerae M66-2]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT23718 NC_012580:401321-401578 [Vibrio cholerae M66-2]
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |