Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 422818..423222 | Replicon | chromosome |
Accession | NZ_CP013304 | ||
Organism | Vibrio cholerae strain CRC711 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | ASZ82_RS16690 | Protein ID | WP_001114075.1 |
Coordinates | 422953..423222 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | ASZ82_RS20195 | Protein ID | WP_099607150.1 |
Coordinates | 422818..422922 (+) | Length | 35 a.a. |
Genomic Context
Location: 418319..419236 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 419393..419782 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 419918..420127 (210 bp)
Type: Others
Protein ID: Protein_449
Type: Others
Protein ID: Protein_449
Location: 420246..420683 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 420747..420965 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 421140..422012 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 422162..422761 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 422818..422922 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 422953..423222 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 423216..423737 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 424036..424161 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 424412..424807 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 425699..426214 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 426398..426811 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 424946..425224 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 425221..425505 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ82_RS16645 | 418319..419236 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
ASZ82_RS16655 | 419393..419782 | + | 390 | WP_001081302.1 | hypothetical protein | - |
ASZ82_RS16660 | 419918..420127 | + | 210 | Protein_449 | GNAT family N-acetyltransferase | - |
ASZ82_RS16665 | 420246..420683 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
ASZ82_RS16670 | 420747..420965 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
ASZ82_RS16680 | 421140..422012 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
ASZ82_RS16685 | 422162..422761 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
ASZ82_RS20195 | 422818..422922 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
ASZ82_RS16690 | 422953..423222 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
ASZ82_RS16695 | 423216..423737 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
ASZ82_RS20200 | 424036..424161 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
ASZ82_RS16710 | 424412..424807 | + | 396 | WP_001000867.1 | hypothetical protein | - |
ASZ82_RS16715 | 424946..425224 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
ASZ82_RS16720 | 425221..425505 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
ASZ82_RS16725 | 425699..426214 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
ASZ82_RS16730 | 426398..426811 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304736..427674 | 122938 | |
- | inside | Integron | - | - | 309816..427298 | 117482 | |
flank | IS/Tn | - | - | 420246..420683 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T58254 WP_001114075.1 NZ_CP013304:422953-423222 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T58254 NZ_CP013304:422953-423222 [Vibrio cholerae]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT58254 WP_099607150.1 NZ_CP013304:422818-422922 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT58254 NZ_CP013304:422818-422922 [Vibrio cholerae]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |