Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 1515814..1516218 | Replicon | chromosome |
Accession | NZ_AP018677 | ||
Organism | Vibrio cholerae strain V060002 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | V060002_RS07300 | Protein ID | WP_001114075.1 |
Coordinates | 1515814..1516083 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | V060002_RS07305 | Protein ID | WP_099607150.1 |
Coordinates | 1516114..1516218 (-) | Length | 35 a.a. |
Genomic Context
Location: 1513531..1513815 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Location: 1513812..1514090 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 1512225..1512638 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 1512822..1513337 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 1514229..1514624 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 1514875..1515000 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 1515299..1515820 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 1515814..1516083 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 1516114..1516218 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 1516275..1516874 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 1517024..1517896 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 1518071..1518289 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 1518353..1518790 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 1518909..1519118 (210 bp)
Type: Others
Protein ID: Protein_1355
Type: Others
Protein ID: Protein_1355
Location: 1519254..1519643 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 1519800..1520717 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
V060002_RS07255 | 1512225..1512638 | - | 414 | WP_000049420.1 | VOC family protein | - |
V060002_RS07265 | 1512822..1513337 | - | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
V060002_RS07270 | 1513531..1513815 | + | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
V060002_RS07275 | 1513812..1514090 | + | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
V060002_RS07280 | 1514229..1514624 | - | 396 | WP_001000867.1 | hypothetical protein | - |
V060002_RS07290 | 1514875..1515000 | - | 126 | WP_001905700.1 | DUF645 family protein | - |
V060002_RS07295 | 1515299..1515820 | - | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
V060002_RS07300 | 1515814..1516083 | - | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
V060002_RS07305 | 1516114..1516218 | - | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
V060002_RS07310 | 1516275..1516874 | - | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
V060002_RS07315 | 1517024..1517896 | - | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
V060002_RS07320 | 1518071..1518289 | - | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
V060002_RS07325 | 1518353..1518790 | - | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
V060002_RS07330 | 1518909..1519118 | - | 210 | Protein_1355 | GNAT family N-acetyltransferase | - |
V060002_RS07335 | 1519254..1519643 | - | 390 | WP_001081302.1 | hypothetical protein | - |
V060002_RS07340 | 1519800..1520717 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 1516275..1622843 | 106568 | |
flank | IS/Tn | - | - | 1518353..1518790 | 437 | ||
- | inside | Integron | - | - | 1511738..1563819 | 52081 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T31951 WP_001114075.1 NZ_AP018677:c1516083-1515814 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T31951 NZ_AP018677:c1516083-1515814 [Vibrio cholerae]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT31951 WP_099607150.1 NZ_AP018677:c1516218-1516114 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT31951 NZ_AP018677:c1516218-1516114 [Vibrio cholerae]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |