Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higB-phd/HigB(toxin) |
Location | 389042..389492 | Replicon | chromosome |
Accession | NZ_CP053803 | ||
Organism | Vibrio cholerae strain L6G |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | HPY16_RS14765 | Protein ID | WP_175248422.1 |
Coordinates | 389205..389492 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | HPY16_RS14760 | Protein ID | WP_175248421.1 |
Coordinates | 389042..389164 (+) | Length | 41 a.a. |
Genomic Context
Location: 384207..384440 (234 bp)
Type: Others
Protein ID: WP_175248420.1
Type: Others
Protein ID: WP_175248420.1
Location: 384484..384921 (438 bp)
Type: Others
Protein ID: WP_000503164.1
Type: Others
Protein ID: WP_000503164.1
Location: 384981..385280 (300 bp)
Type: Others
Protein ID: Protein_389
Type: Others
Protein ID: Protein_389
Location: 385487..385777 (291 bp)
Type: Others
Protein ID: WP_080536237.1
Type: Others
Protein ID: WP_080536237.1
Location: 385802..385921 (120 bp)
Type: Others
Protein ID: WP_020977912.1
Type: Others
Protein ID: WP_020977912.1
Location: 385958..386497 (540 bp)
Type: Others
Protein ID: WP_175231429.1
Type: Others
Protein ID: WP_175231429.1
Location: 386649..387224 (576 bp)
Type: Others
Protein ID: WP_094129300.1
Type: Others
Protein ID: WP_094129300.1
Location: 387265..387342 (78 bp)
Type: Others
Protein ID: WP_175248608.1
Type: Others
Protein ID: WP_175248608.1
Location: 387492..387723 (232 bp)
Type: Others
Protein ID: Protein_395
Type: Others
Protein ID: Protein_395
Location: 387910..388197 (288 bp)
Type: Others
Protein ID: WP_000654672.1
Type: Others
Protein ID: WP_000654672.1
Location: 388328..389035 (708 bp)
Type: Others
Protein ID: WP_057562218.1
Type: Others
Protein ID: WP_057562218.1
Location: 389042..389164 (123 bp)
Type: Antitoxin
Protein ID: WP_175248421.1
Type: Antitoxin
Protein ID: WP_175248421.1
Location: 389205..389492 (288 bp)
Type: Toxin
Protein ID: WP_175248422.1
Type: Toxin
Protein ID: WP_175248422.1
Location: 389503..389820 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 389967..390476 (510 bp)
Type: Others
Protein ID: WP_002053638.1
Type: Others
Protein ID: WP_002053638.1
Location: 390595..391257 (663 bp)
Type: Others
Protein ID: WP_000084914.1
Type: Others
Protein ID: WP_000084914.1
Location: 391424..392449 (1026 bp)
Type: Others
Protein ID: WP_175231413.1
Type: Others
Protein ID: WP_175231413.1
Location: 392445..392567 (123 bp)
Type: Others
Protein ID: WP_175231869.1
Type: Others
Protein ID: WP_175231869.1
Location: 392603..393019 (417 bp)
Type: Others
Protein ID: WP_175248423.1
Type: Others
Protein ID: WP_175248423.1
Location: 393196..394083 (888 bp)
Type: Others
Protein ID: WP_175248424.1
Type: Others
Protein ID: WP_175248424.1
Location: 394108..394201 (94 bp)
Type: Others
Protein ID: Protein_407
Type: Others
Protein ID: Protein_407
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HPY16_RS14705 | 384207..384440 | + | 234 | WP_175248420.1 | hypothetical protein | - |
HPY16_RS14710 | 384484..384921 | + | 438 | WP_000503164.1 | IS200/IS605-like element IS1004 family transposase | - |
HPY16_RS14715 | 384981..385280 | + | 300 | Protein_389 | GNAT family N-acetyltransferase | - |
HPY16_RS14720 | 385487..385777 | + | 291 | WP_080536237.1 | YkgJ family cysteine cluster protein | - |
HPY16_RS14725 | 385802..385921 | + | 120 | WP_020977912.1 | DUF3265 domain-containing protein | - |
HPY16_RS14730 | 385958..386497 | + | 540 | WP_175231429.1 | hydrolase | - |
HPY16_RS14735 | 386649..387224 | + | 576 | WP_094129300.1 | hypothetical protein | - |
HPY16_RS14740 | 387265..387342 | + | 78 | WP_175248608.1 | hypothetical protein | - |
HPY16_RS14745 | 387492..387723 | + | 232 | Protein_395 | DUF645 family protein | - |
HPY16_RS14750 | 387910..388197 | + | 288 | WP_000654672.1 | hypothetical protein | - |
HPY16_RS14755 | 388328..389035 | + | 708 | WP_057562218.1 | HAD family hydrolase | - |
HPY16_RS14760 | 389042..389164 | + | 123 | WP_175248421.1 | acetyltransferase | Antitoxin |
HPY16_RS14765 | 389205..389492 | + | 288 | WP_175248422.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HPY16_RS14770 | 389503..389820 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
HPY16_RS14775 | 389967..390476 | + | 510 | WP_002053638.1 | GNAT family N-acetyltransferase | - |
HPY16_RS14780 | 390595..391257 | + | 663 | WP_000084914.1 | Vat family streptogramin A O-acetyltransferase | - |
HPY16_RS14785 | 391424..392449 | + | 1026 | WP_175231413.1 | hypothetical protein | - |
HPY16_RS14790 | 392445..392567 | + | 123 | WP_175231869.1 | DUF3265 domain-containing protein | - |
HPY16_RS14795 | 392603..393019 | + | 417 | WP_175248423.1 | ASCH domain-containing protein | - |
HPY16_RS14800 | 393196..394083 | + | 888 | WP_175248424.1 | FRG domain-containing protein | - |
HPY16_RS14805 | 394108..394201 | + | 94 | Protein_407 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | blaCARB-7 | - | 309435..510278 | 200843 | |
- | inside | Integron | - | - | 310548..509407 | 198859 | |
flank | IS/Tn | - | - | 384484..384921 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11322.92 Da Isoelectric Point: 6.7187
>T157924 WP_175248422.1 NZ_CP053803:389205-389492 [Vibrio cholerae]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGSLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGSLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
Download Length: 288 bp
>T157924 NZ_CP069517:c1111541-1111263 [Escherichia coli]
ATGATAATGAATTTCAGACACAAGGGATTGCGTGACTTGTTTCTTCTCGGCAAAACCTCCGGCGTTATACCGACGCAAGT
CAAACGATTACGCCACCGACTCGCTGTGATTGATGCAGCATGCTGTCTTGCTGATATCGATATGCCCGGTTACCGACTAC
ATCCGTTAAGCGGCGATCGCGATGGAATTTGGGCGATATCTGTCTCGGGCAACTGGCGAATCACATTTGAATTCGTCAAT
GGCGATGCATACATACTGGATTACGAGGACTATCACTGA
ATGATAATGAATTTCAGACACAAGGGATTGCGTGACTTGTTTCTTCTCGGCAAAACCTCCGGCGTTATACCGACGCAAGT
CAAACGATTACGCCACCGACTCGCTGTGATTGATGCAGCATGCTGTCTTGCTGATATCGATATGCCCGGTTACCGACTAC
ATCCGTTAAGCGGCGATCGCGATGGAATTTGGGCGATATCTGTCTCGGGCAACTGGCGAATCACATTTGAATTCGTCAAT
GGCGATGCATACATACTGGATTACGAGGACTATCACTGA
Antitoxin
Download Length: 41 a.a. Molecular weight: 4646.83 Da Isoelectric Point: 12.1021
>AT157924 WP_175248421.1 NZ_CP053803:389042-389164 [Vibrio cholerae]
VVSVVVIKFSVMRCQPLRRALCTFLKSFLQIKLVHSVIMR
VVSVVVIKFSVMRCQPLRRALCTFLKSFLQIKLVHSVIMR
Download Length: 123 bp
>AT157924 NZ_CP069517:c1111263-1110979 [Escherichia coli]
ATGAAAATGGCCAATCATCCCCGCCCGGGGGACATTATTCAGGAATCACTGGACGAACTTAATGTCAGCCTGCGCGAGTT
TGCCAGAGCAATGGAAATTGCGCCCTCAACGGCAAGCCGATTGCTGACCGGAAAAGCAGCTTTGACGCCAGAAATGGCAA
TAAAACTTTCCGTGGTGATCGGCAGTTCGCCGCAAATGTGGCTGAATCTGCAAAATGCCTGGAGTCTGGCAGAGGCGGAA
AAAACGGTGGATGTGTCGCGACTGCGCCGTCTGGTTACGCAATAA
ATGAAAATGGCCAATCATCCCCGCCCGGGGGACATTATTCAGGAATCACTGGACGAACTTAATGTCAGCCTGCGCGAGTT
TGCCAGAGCAATGGAAATTGCGCCCTCAACGGCAAGCCGATTGCTGACCGGAAAAGCAGCTTTGACGCCAGAAATGGCAA
TAAAACTTTCCGTGGTGATCGGCAGTTCGCCGCAAATGTGGCTGAATCTGCAAAATGCCTGGAGTCTGGCAGAGGCGGAA
AAAACGGTGGATGTGTCGCGACTGCGCCGTCTGGTTACGCAATAA