Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 707246..707824 | Replicon | chromosome |
Accession | NZ_CP053807 | ||
Organism | Vibrio cholerae strain SP6G |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | HPY07_RS17020 | Protein ID | WP_001180243.1 |
Coordinates | 707507..707824 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | HPY07_RS17015 | Protein ID | WP_001961623.1 |
Coordinates | 707246..707488 (+) | Length | 81 a.a. |
Genomic Context
Location: 703791..704063 (273 bp)
Type: Others
Protein ID: WP_000246255.1
Type: Others
Protein ID: WP_000246255.1
Location: 704060..704557 (498 bp)
Type: Others
Protein ID: WP_000982256.1
Type: Others
Protein ID: WP_000982256.1
Location: 707246..707488 (243 bp)
Type: Antitoxin
Protein ID: WP_001961623.1
Type: Antitoxin
Protein ID: WP_001961623.1
Location: 707507..707824 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 709811..710059 (249 bp)
Type: Others
Protein ID: WP_000213183.1
Type: Others
Protein ID: WP_000213183.1
Location: 710049..710339 (291 bp)
Type: Others
Protein ID: WP_000221352.1
Type: Others
Protein ID: WP_000221352.1
Location: 702297..702734 (438 bp)
Type: Others
Protein ID: WP_000503164.1
Type: Others
Protein ID: WP_000503164.1
Location: 703084..703560 (477 bp)
Type: Others
Protein ID: WP_001047188.1
Type: Others
Protein ID: WP_001047188.1
Location: 704832..705155 (324 bp)
Type: Others
Protein ID: WP_080299109.1
Type: Others
Protein ID: WP_080299109.1
Location: 705350..705739 (390 bp)
Type: Others
Protein ID: WP_175242351.1
Type: Others
Protein ID: WP_175242351.1
Location: 705803..706654 (852 bp)
Type: Others
Protein ID: WP_175242301.1
Type: Others
Protein ID: WP_175242301.1
Location: 706738..706959 (222 bp)
Type: Others
Protein ID: Protein_728
Type: Others
Protein ID: Protein_728
Location: 707960..708390 (431 bp)
Type: Others
Protein ID: Protein_731
Type: Others
Protein ID: Protein_731
Location: 708643..709080 (438 bp)
Type: Others
Protein ID: WP_114818872.1
Type: Others
Protein ID: WP_114818872.1
Location: 709078..709155 (78 bp)
Type: Others
Protein ID: Protein_733
Type: Others
Protein ID: Protein_733
Location: 709279..709389 (111 bp)
Type: Others
Protein ID: Protein_734
Type: Others
Protein ID: Protein_734
Location: 710388..710948 (561 bp)
Type: Others
Protein ID: WP_114716203.1
Type: Others
Protein ID: WP_114716203.1
Location: 711274..711435 (162 bp)
Type: Others
Protein ID: WP_175242352.1
Type: Others
Protein ID: WP_175242352.1
Location: 711554..712558 (1005 bp)
Type: Others
Protein ID: WP_000964932.1
Type: Others
Protein ID: WP_000964932.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HPY07_RS16975 | 702297..702734 | - | 438 | WP_000503164.1 | IS200/IS605-like element IS1004 family transposase | - |
HPY07_RS16980 | 703084..703560 | - | 477 | WP_001047188.1 | GNAT family N-acetyltransferase | - |
HPY07_RS16985 | 703791..704063 | + | 273 | WP_000246255.1 | DUF1778 domain-containing protein | - |
HPY07_RS16990 | 704060..704557 | + | 498 | WP_000982256.1 | GNAT family N-acetyltransferase | - |
HPY07_RS16995 | 704832..705155 | - | 324 | WP_080299109.1 | DUF3709 domain-containing protein | - |
HPY07_RS17000 | 705350..705739 | - | 390 | WP_175242351.1 | VOC family protein | - |
HPY07_RS17005 | 705803..706654 | - | 852 | WP_175242301.1 | IS3 family transposase | - |
HPY07_RS17010 | 706738..706959 | - | 222 | Protein_728 | transposase | - |
HPY07_RS17015 | 707246..707488 | + | 243 | WP_001961623.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
HPY07_RS17020 | 707507..707824 | + | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HPY07_RS17025 | 707960..708390 | - | 431 | Protein_731 | nucleotidyltransferase family protein | - |
HPY07_RS17030 | 708643..709080 | - | 438 | WP_114818872.1 | NUDIX pyrophosphatase | - |
HPY07_RS17035 | 709078..709155 | - | 78 | Protein_733 | GNAT family N-acetyltransferase | - |
HPY07_RS17040 | 709279..709389 | - | 111 | Protein_734 | DUF645 family protein | - |
HPY07_RS17045 | 709811..710059 | + | 249 | WP_000213183.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
HPY07_RS17050 | 710049..710339 | + | 291 | WP_000221352.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HPY07_RS17055 | 710388..710948 | - | 561 | WP_114716203.1 | GNAT family N-acetyltransferase | - |
HPY07_RS17060 | 711274..711435 | - | 162 | WP_175242352.1 | hypothetical protein | - |
HPY07_RS17065 | 711554..712558 | - | 1005 | WP_000964932.1 | LD-carboxypeptidase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 702297..702734 | 437 | ||
- | inside | Genomic island | - | - | 703084..723599 | 20515 | |
- | inside | Integron | - | - | 703084..719384 | 16300 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T157971 WP_001180243.1 NZ_CP053807:707507-707824 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T157971 NZ_CP069528:1031716-1031967 [Escherichia coli]
ATGCGTACAATTAGCTACAGCGAAGCGCGTCAGAATTTGTCGGCAACAATGATGAAAGCCGTTGAAGATCATGCCCCGAT
CCTCATTACTCGTCAGAATGGAGAGGCTTGTGTTCTGATGTCACTCGAAGAATACAACTCGCTGGAAGAGACGGCTTATC
TACTGCGTTCCCCCGCTAACGCCCGGAGATTGATGGACTCAATCGATAGCCTGAAATCAGGCAAAGGAACGGAAAAGGAC
ATTATTGAGTGA
ATGCGTACAATTAGCTACAGCGAAGCGCGTCAGAATTTGTCGGCAACAATGATGAAAGCCGTTGAAGATCATGCCCCGAT
CCTCATTACTCGTCAGAATGGAGAGGCTTGTGTTCTGATGTCACTCGAAGAATACAACTCGCTGGAAGAGACGGCTTATC
TACTGCGTTCCCCCGCTAACGCCCGGAGATTGATGGACTCAATCGATAGCCTGAAATCAGGCAAAGGAACGGAAAAGGAC
ATTATTGAGTGA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8931.22 Da Isoelectric Point: 5.6630
>AT157971 WP_001961623.1 NZ_CP053807:707246-707488 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDGGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDGGKTVDGATFLNTL
Download Length: 243 bp
>AT157971 NZ_CP069528:1031964-1032218 [Escherichia coli]
GTGAAACTAATCTGGTCTGAGGAATCATGGGATGATTATCTGTACTGGCAGGAAACAGATAAGCGAATTGTTAAAAAGAT
CAATGAAATTATCAAAGATACACGCAGAACACCATTTGAAGGTAAGGGGAAGCCAGAACCCCTGAAACATAATTTGTCAG
GCTTCTGGTCCCGACGCATTACAGAGGAGCACCGTCTGGTATACGCGGTTACCGACGATTCACTGCTCATTGCAGCATGT
CGTTATCATTATTGA
GTGAAACTAATCTGGTCTGAGGAATCATGGGATGATTATCTGTACTGGCAGGAAACAGATAAGCGAATTGTTAAAAAGAT
CAATGAAATTATCAAAGATACACGCAGAACACCATTTGAAGGTAAGGGGAAGCCAGAACCCCTGAAACATAATTTGTCAG
GCTTCTGGTCCCGACGCATTACAGAGGAGCACCGTCTGGTATACGCGGTTACCGACGATTCACTGCTCATTGCAGCATGT
CGTTATCATTATTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |