Detailed information of TA system TA001041

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): relBE/RHH-RelE
• Location: 1643370..1643896
• Replicon: chromosome
• Accession: NC_000913
• Organism: Escherichia coli str. K-12 substr. MG1655

Toxin (Protein)

• Gene name: relE
• Uniprot ID: P0C077
• Locus tag: b1563
• Protein ID: NP_416081.1
• Coordinates: 1645346..1645633 (-)
• Length: 96 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: P0C079
• Locus tag: b1564
• Protein ID: NP_416082.1
• Coordinates: 1645633..1645872 (-)
• Length: 80 a.a.

Genomic Context

Location: 1640805..1640975 (171 bp)
Type: Others
Protein ID: YP_010051186.1

Location: 1641855..1642067 (213 bp)
Type: Others
Protein ID: NP_416076.1

Location: 1642122..1642211 (90 bp)
Type: Others
Protein ID: YP_009518791.1

Location: 1645897..1646202 (306 bp)
Type: Others
Protein ID: NP_416083.1

Location: 1646405..1646737 (333 bp)
Type: Others
Protein ID: NP_416084.1

Location: 1647934..1648341 (408 bp)
Type: Others
Protein ID: NP_416088.1

Location: 1648508..1648663 (156 bp)
Type: Others
Protein ID: NP_416089.1

Location: 1648665..1648793 (129 bp)
Type: Others
Protein ID: NP_416090.2

Location: 1638455..1638667 (213 bp)
Type: Others
Protein ID: NP_416070.1

Location: 1639030..1639527 (498 bp)
Type: Others
Protein ID: NP_416071.1

Location: 1639080..1639334 (255 bp)
Type: Others
Protein ID: YP_002791241.1

Location: 1639524..1640057 (534 bp)
Type: Others
Protein ID: NP_416072.1

Location: 1640054..1640365 (312 bp)
Type: Others
Protein ID: NP_416073.1

Location: 1640370..1640585 (216 bp)
Type: Others
Protein ID: NP_416074.4

Location: 1641339..1641554 (216 bp)
Type: Others
Protein ID: NP_416075.1

Location: 1642489..1643241 (753 bp)
Type: Others
Protein ID: NP_416077.4

Location: 1643255..1644304 (1050 bp)
Type: Others
Protein ID: NP_416078.4

Location: 1644651..1644902 (252 bp)
Type: Others
Protein ID: NP_416079.1

Location: 1645119..1645274 (156 bp)
Type: Others
Protein ID: NP_416080.1

Location: 1645346..1645633 (288 bp)
Type: Toxin
Protein ID: NP_416081.1

Location: 1645633..1645872 (240 bp)
Type: Antitoxin
Protein ID: NP_416082.1

Location: 1647174..1647323 (150 bp)
Type: Others
Protein ID: YP_009518792.1

Location: 1647346..1647636 (291 bp)
Type: Others
Protein ID: YP_009518793.1

Location: 1647620..1647850 (231 bp)
Type: Others
Protein ID: NP_416087.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
b1552	1638455..1638667	-	213	NP_416070.1	cold shock-like protein CspI	-
b1553	1639030..1639527	-	498	NP_416071.1	DUF2514 domain-containing protein RzpQ	-
b4689	1639080..1639334	-	255	YP_002791241.1	putative lipoprotein RzoQ	-
b1554	1639524..1640057	-	534	NP_416072.1	putative lysozyme	-
b1555	1640054..1640365	-	312	NP_416073.1	protein YdfR	-
b1556	1640370..1640585	-	216	NP_416074.4	putative prophage lysis protein EssQ	-
b4776	1640805..1640975	+	171	YP_010051186.1	putative zinc-binding protein YnfU	-
b1557	1641339..1641554	-	216	NP_416075.1	cold shock-like protein CspB	-
b1558	1641855..1642067	+	213	NP_416076.1	cold shock-like protein CspF	-
b4750	1642122..1642211	+	90	YP_009518791.1	protein YnfS	-
b1559	1642489..1643241	-	753	NP_416077.4	putative antitermination protein Q	-
b1560	1643255..1644304	-	1050	NP_416078.4	protein YdfU	-
b1561	1644651..1644902	-	252	NP_416079.1	protein Rem	-
b1562	1645119..1645274	-	156	NP_416080.1	toxic protein HokD	-
b1563	1645346..1645633	-	288	NP_416081.1	mRNA interferase toxin RelE	Toxin
b1564	1645633..1645872	-	240	NP_416082.1	antitoxin/DNA-binding transcriptional repressor RelB	Antitoxin
b1565	1645897..1646202	+	306	NP_416083.1	protein YdfV	-
b1566	1646405..1646737	+	333	NP_416084.1	PF14282 family protein FlxA	-
b1567	1647174..1647323	-	150	YP_009518792.1	protein YdfW	-
b1568	1647346..1647636	-	291	YP_009518793.1	protein YdfX	-
b1569	1647620..1647850	-	231	NP_416087.1	putative DNA-binding transcriptional regulator DicC	-
b1570	1647934..1648341	+	408	NP_416088.1	DNA-binding transcriptional dual regulator DicA	-
b1571	1648508..1648663	+	156	NP_416089.1	DUF1391 domain-containing protein YdfA	-
b1572	1648665..1648793	+	129	NP_416090.2	uncharacterized protein YdfB	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View HG738867 Escherichia coli str. K-12 substr. MC4100 Prophage TA020067 1519531..1552992 0 View NC_012759 Escherichia coli BW2952 Prophage TA023854 1521085..1554546 0 View NZ_CP009273 Escherichia coli BW25113 Prophage TA048683 1625259..1658720 0 View HG738867 Escherichia coli str. K-12 substr. MC4100 Prophage TA020067 1519531..1552992 0 View NC_010473 Escherichia coli str. K-12 substr. DH10B Prophage TA022686 1718651..1753448 0 View NZ_HG738867 Escherichia coli str. K-12 substr. MC4100 strain K-12 Prophage TA285017 1519531..1552992 0 View NC_017625 Escherichia coli DH1 Prophage TA027170 2221734..2249263 0.009 View NZ_AP021946 Escherichia coli strain WP2-S18-ESBL-08 Prophage TA033893 2451962..2495155 0.008 View NZ_CP010439 Escherichia coli K-12 strain K-12 MG1655 Prophage TA052469 2371482..2397224 0.008 View NZ_CP010441 Escherichia coli K-12 strain K-12 MG1655 Prophage TA052548 2374573..2408034 0 View NZ_CP011113 Escherichia coli strain RR1 Prophage TA053405 1593305..1621509 0.007 View NZ_CP011124 Escherichia coli strain USML2 Prophage TA053503 3209613..3249971 0.004 View NZ_CP012127 Escherichia coli strain DH1Ec169 Prophage TA055926 1610572..1644033 0 View NZ_CP012868 Escherichia coli str. K-12 substr. MG1655 strain K-12 Prophage TA057308 2977202..3010663 0 View NZ_CP012869 Escherichia coli strain K-12 substr. MG1655_TMP32XR1 Prophage TA057339 2977209..3010670 0 View NZ_CP012870 Escherichia coli strain K-12 substr. MG1655_TMP32XR2 Prophage TA057370 2977209..3010670 0 View NZ_CP013952 Escherichia coli strain HST04 Prophage TA059671 4226718..4253586 0.006 View NZ_CP014225 Escherichia coli str. K-12 substr. MG1655 strain K-12 Prophage TA060414 4469926..4503387 0 View NZ_CP014348 Escherichia coli str. K-12 substr. MG1655 strain JW5437-1 Prophage TA060779 3669648..3710006 0.004 View NZ_CP018801 Escherichia coli strain tolC- Prophage TA070553 2221021..2255818 0 View NZ_CP019629 Escherichia coli strain MGY Prophage TA073076 1631002..1664463 0 View NZ_CP025268 Escherichia coli str. K-12 substr. MG1655 strain K-12 Prophage TA089996 1635821..1669281 0 View NZ_CP026342 Escherichia coli strain 9FA Prophage TA093861 1631002..1657870 0.006 View NZ_CP026343 Escherichia coli strain 9A Prophage TA093904 1631001..1664462 0 View NZ_CP026344 Escherichia coli strain 8FA Prophage TA093947 1631002..1664463 0 View NZ_CP026345 Escherichia coli strain 8A Prophage TA093990 1629453..1657870 0.008 View NZ_CP026346 Escherichia coli strain 7FA Prophage TA094033 1631002..1657870 0.006 View NZ_CP026347 Escherichia coli strain 7A Prophage TA094076 1631002..1664463 0 View NZ_CP026348 Escherichia coli strain 6FA Prophage TA094119 1631002..1664463 0 View NZ_CP026349 Escherichia coli strain 6A Prophage TA094162 1631002..1664463 0 View NZ_CP026350 Escherichia coli strain 5FA Prophage TA094205 1631002..1664463 0 View NZ_CP026351 Escherichia coli strain 5A Prophage TA094248 1631002..1657870 0.006 View NZ_CP026352 Escherichia coli strain 4FA Prophage TA094291 1631002..1657870 0.006 View NZ_CP026354 Escherichia coli strain 3FA Prophage TA094377 1629215..1656744 0.009 View NZ_CP026355 Escherichia coli strain 3A Prophage TA094420 1631002..1664463 0 View NZ_CP026356 Escherichia coli strain 2FA Prophage TA094463 1631002..1664463 0 View NZ_CP026357 Escherichia coli strain 2F_0 Prophage TA094506 1631002..1664463 0 View NZ_CP026358 Escherichia coli strain 2A Prophage TA094549 1631002..1657870 0.006 View NZ_CP026359 Escherichia coli strain 2_0 Prophage TA094592 1631002..1664463 0 View NZ_CP026360 Escherichia coli strain 1FA Prophage TA094635 1631002..1664463 0 View NZ_CP026361 Escherichia coli strain 1A Prophage TA094678 1631002..1664463 0 View NZ_CP029238 Escherichia coli strain CJ236 Prophage TA105250 1631002..1664463 0 View NZ_CP030240 Escherichia coli strain ER1709 Prophage TA107391 3759929..3794723 0 View NZ_CP031214 Escherichia coli strain C600 Prophage TA108583 2258054..2298412 0.004 View NZ_CP032667 Escherichia coli str. K-12 substr. MG1655 strain K-12 Prophage TA112075 2218134..2258492 0.004 View NZ_CP032679 Escherichia coli str. K-12 substr. MG1655 strain K-12 Prophage TA112107 1631007..1664468 0 View NZ_CP034595 Escherichia coli strain WCHEC035053S1G0 Prophage TA116275 2080640..2114101 0 View NZ_CP037857 Escherichia coli BW25113 strain AM187 Prophage TA120213 1624921..1658382 0 View NZ_CP040643 Escherichia coli strain BE104 Prophage TA126265 1764966..1798427 0 View NZ_CP040663 Escherichia coli strain EK2009 Prophage TA126352 1619919..1653380 0 View NZ_CP040667 Escherichia coli strain S17-1 Prophage TA126454 1751269..1784730 0 View NZ_CP042843 Escherichia coli strain JME67 Prophage TA136091 2340491..2373952 0 View NZ_CP042845 Escherichia coli strain JME65 Prophage TA136177 2335378..2368839 0 View NZ_CP042846 Escherichia coli strain JME64 Prophage TA136220 2330497..2363958 0 View NZ_CP042865 Escherichia coli strain ATCC BAA-196 Prophage TA136307 2229091..2255959 0.006 View NZ_CP042867 Escherichia coli strain ATCC BAA-196 Prophage TA136338 2228999..2255867 0.006 View NZ_CP043183 Escherichia coli O16:H48 strain PG20180172 Prophage TA137410 2220212..2253673 0 View NZ_CP043185 Escherichia coli O16:H48 strain PG20180171 Prophage TA137428 360597..386339 0.008 View NZ_CP043187 Escherichia coli O16:H48 strain PG20180170 Prophage TA137478 2220208..2253669 0 View NZ_CP043189 Escherichia coli O16:H48 strain PG20180175 Prophage TA137509 2220211..2253672 0 View NZ_CP043191 Escherichia coli O16:H48 strain PG20180173 Prophage TA137541 2220211..2253672 0 View NZ_CP043193 Escherichia coli O16:H48 strain PG20180063 Prophage TA137571 2226806..2253674 0.007 View NZ_CP043195 Escherichia coli O16:H48 strain PG20180062 Prophage TA137602 2508272..2548630 0.004 View NZ_CP043197 Escherichia coli O16:H48 strain PG20180061 Prophage TA137642 4199959..4240317 0.005 View NZ_CP043201 Escherichia coli O16:H48 strain PG20180059 Prophage TA137711 2220211..2253672 0 View NZ_CP043203 Escherichia coli O16:H48 strain PG20180058 Prophage TA137744 2220211..2253672 0 View NZ_CP043205 Escherichia coli O16:H48 strain PG20180054 Prophage TA137777 2227930..2253672 0.008 View NZ_CP043207 Escherichia coli O16:H48 strain PG20180053 Prophage TA137810 2220211..2253672 0 View NZ_CP043209 Escherichia coli O16:H48 strain PG20180052 Prophage TA137843 2220211..2253672 0 View NZ_CP045741 Escherichia coli strain DH5alpha Prophage TA142456 3271084..3299468 0.01 View NZ_CP047127 Escherichia coli K-12 Prophage TA145467 4091062..4119454 0.01 View NZ_CP047594 Escherichia coli strain LD27-1 Prophage TA146827 2235900..2267399 0.008 View NZ_CP053603 Escherichia coli strain Dam/Dcm Prophage TA157065 1615047..1641915 0.006 View NZ_CP054665 Escherichia coli strain IGC_EcoliInv_1.1 Prophage TA160046 1635819..1661561 0.008 View NZ_CP062239 Escherichia coli strain AML001_ev03 Prophage TA173646 1625259..1658720 0 View NZ_CP062240 Escherichia coli strain AML001_ev02 Prophage TA173689 1622609..1651001 0.01 View NZ_CP062241 Escherichia coli strain AML001_ev01 Prophage TA173732 1625259..1658720 0 View NZ_CP062242 Escherichia coli strain AML001_par Prophage TA173775 1625259..1652127 0.006 View NZ_CP062243 Escherichia coli strain AML003_ev03 Prophage TA173818 1625259..1658720 0 View NZ_CP062244 Escherichia coli strain AML003_ev02 Prophage TA173861 1625259..1658720 0 View NZ_CP062245 Escherichia coli strain AML003_ev01 Prophage TA173904 1625258..1658719 0 View NZ_CP062246 Escherichia coli strain AML003_par Prophage TA173947 1625259..1658720 0 View NZ_CP062248 Escherichia coli strain AML002_ev02 Prophage TA174033 1625260..1652128 0.006 View NZ_CP062250 Escherichia coli strain AML002_par Prophage TA174119 1625259..1658720 0 View NZ_CP064678 Escherichia coli K-12 strain CETR3G40 Prophage TA181427 1625259..1658720 0 View NZ_CP064679 Escherichia coli K-12 strain CETR2G40 Prophage TA181470 1625259..1652127 0.006 View NZ_CP064680 Escherichia coli K-12 strain CETR1G40 Prophage TA181513 1625257..1658718 0 View NZ_CP064681 Escherichia coli K-12 strain BZKR3G40 Prophage TA181556 1625259..1652127 0.006 View NZ_CP064682 Escherichia coli K-12 strain BZKR2G40 Prophage TA181599 1625259..1658720 0 View NZ_CP067994 Escherichia coli strain CV601 Prophage TA186401 2221463..2254924 0 View NZ_CP068281 Escherichia coli strain CY706 Prophage TA187058 2874303..2909100 0 View NZ_CP069132 Escherichia coli BW25113 substr. CHXR1G20 Prophage TA189919 1625255..1658716 0 View NZ_CP069133 Escherichia coli BW25113 substr. CHXR2G20 Prophage TA189962 1625259..1658720 0 View NZ_CP069386 Escherichia coli strain XH1815 Prophage TA190295 261320..294781 0 View NZ_CP070962 Escherichia coli strain K-12 J53 Prophage TA194816 1907593..1935799 0.007 View NZ_CP071521 Escherichia coli strain 11202 Prophage TA196524 2215898..2254488 0.004 View NZ_CP072054 Escherichia coli strain K1508 Prophage TA197259 1519531..1552992 0 View NZ_CP075722 Escherichia coli strain CPE35 Prophage TA204324 2222554..2259693 0.008 View NZ_CP076043 Escherichia coli strain Stbl4 Prophage TA204590 1160875..1190368 0.004 View NZ_CP076470 Escherichia coli strain DH5a Prophage TA205746 4079180..4114005 0 View NZ_CP077969 Escherichia coli strain JM83 Prophage TA208757 1549815..1583276 0 View NZ_CP079767 Escherichia coli strain SF10 Prophage TA209975 1067917..1100181 0.009 View NZ_CP079991 Escherichia coli strain KMS2005 Prophage TA210463 2485629..2519090 0 View NZ_CP079992 Escherichia coli strain KMS2001 Prophage TA210495 2485630..2519091 0 View NZ_CP079993 Escherichia coli strain EV36 Prophage TA210527 2485630..2519091 0 View NZ_CP083410 Escherichia coli strain RP437 Prophage TA216371 1630999..1664460 0 View NZ_CP084207 Escherichia coli strain EC2648-R1-1 Prophage TA218255 3031857..3059386 0.009 View NZ_CP084209 Escherichia coli strain EC2648-R2 Prophage TA218286 2222730..2250021 0.009 View NZ_CP084897 Escherichia coli strain gb37 Prophage TA219999 1634347..1660089 0.008 View NZ_CP087136 Escherichia coli strain JW5503 Prophage TA224831 1625806..1652674 0.006 View NZ_CP092037 Escherichia coli strain MG1655-377GD Prophage TA235511 1454974..1491108 0.008 View NZ_CP092702 Escherichia coli strain S-P-C-029.01 Prophage TA236980 1631002..1657870 0.006 View NZ_CP093221 Escherichia coli strain ER2683 Prophage TA237841 3343923..3370791 0.006 View NZ_CP093368 Escherichia coli strain EV36 mutant 1a Prophage TA238251 2485630..2512498 0.006 View NZ_CP097881 Escherichia coli str. K-12 substr. MG1655 strain K-12 Prophage TA246421 2218488..2258846 0.004 View NZ_CP097882 Escherichia coli str. K-12 substr. MG1655 strain K-12 Prophage TA246447 2211254..2239646 0.01 View NZ_CP097883 Escherichia coli str. K-12 substr. MG1655 strain K-12 Prophage TA246473 2211254..2239646 0.01 View NZ_CP097884 Escherichia coli str. K-12 substr. MG1655 strain K-12 Prophage TA246500 2828985..2869343 0.004 View NZ_CP099590 Escherichia coli strain WG1 Prophage TA249176 2213004..2249588 0.001 View NZ_CP099590 Escherichia coli strain WG1 Prophage TA249176 2219597..2250451 0.009 View NZ_CP102379 Escherichia coli strain BM28 lysU Prophage TA253541 1503513..1538240 0.001 View NZ_CP102380 Escherichia coli strain BM28 Prophage TA253575 1503513..1538240 0.001 View NZ_CP104326 Escherichia coli strain THB42-F1 Prophage TA257599 2221107..2254568 0 View NZ_CP106994 Escherichia coli strain SY22A6 Prophage TA260129 2226870..2268564 0.005 View NZ_CP106995 Escherichia coli strain SY22B3 Prophage TA260152 2226870..2268564 0.005 View NZ_CP106996 Escherichia coli strain SY22D8 Prophage TA260175 2226870..2268564 0.005 View NZ_CP106997 Escherichia coli strain SY22B6 Prophage TA260198 2226870..2268564 0.005 View NZ_CP106998 Escherichia coli strain SY221 Prophage TA260221 2226870..2268564 0.005 View NZ_CP106999 Escherichia coli strain SY22A4 Prophage TA260244 2226870..2268564 0.005 View NZ_CP107000 Escherichia coli strain SY22B2 Prophage TA260267 2226870..2268564 0.005 View NZ_CP107001 Escherichia coli strain SY22B5 Prophage TA260290 2226870..2268564 0.005 View NZ_CP107002 Escherichia coli strain SY22C3 Prophage TA260313 2226870..2268564 0.005 View NZ_CP107003 Escherichia coli strain SY22B1 Prophage TA260336 2226870..2268564 0.005 View NZ_CP107004 Escherichia coli strain SY22A3 Prophage TA260359 2226870..2268564 0.005 View NZ_CP107005 Escherichia coli strain SY22A1 Prophage TA260382 2226870..2268564 0.005 View NZ_CP110014 Escherichia coli strain HE_100-10 Prophage TA262641 1718639..1753436 0 View NZ_CP110015 Escherichia coli strain HE_150 Prophage TA262667 1718642..1753439 0 View NZ_CP110016 Escherichia coli strain HE_100 Prophage TA262693 1718643..1753440 0 View NZ_CP110017 Escherichia coli strain HE_50 Prophage TA262719 1718642..1753439 0 View NZ_CP110018 Escherichia coli strain DH10B Prophage TA262745 1718651..1753448 0 View NZ_CP110999 Escherichia coli strain J53-p133 Prophage TA264727 2077964..2118322 0.004 View NZ_CP111004 Escherichia coli strain J53-p131 Prophage TA264756 2077964..2118322 0.005 View NZ_CP111008 Escherichia coli strain J53-p130 Prophage TA264784 2077738..2111199 0 View NZ_CP114891 Escherichia coli strain CM2 Prophage TA266905 1702179..1739626 0.002 View NZ_CP114892 Escherichia coli strain CM5 Prophage TA266920 849012..883809 0 View NZ_CP114893 Escherichia coli strain CM13 Prophage TA266961 3451022..3485819 0 View NZ_CP117971 Escherichia coli strain B-1109 Prophage TA272600 2577962..2618799 0.008 View NZ_CP122316 Escherichia coli strain HT-946 Prophage TA276667 1216837..1250298 0 View NZ_CP122318 Escherichia coli strain HT873X1 Prophage TA276729 1250251..1283712 0 View NZ_CP128218 Escherichia coli strain TG1 Prophage TA284417 1253353..1288790 0.002 View NZ_LM995446 Escherichia coli strain K-12 substr. RV308 Prophage TA285435 1579899..1613360 0 View NZ_LN832404 Escherichia coli K-12 substr. AG100 Prophage TA285657 1634656..1668117 0 View NZ_LR881938 Escherichia coli str. K-12 substr. MG1655 strain K-12 Prophage TA289514 1615271..1648732 0 View NZ_LR882052 Escherichia coli isolate 2015-01-466 Prophage TA289589 2200582..2239192 0.006 View NZ_LT615377 Escherichia coli isolate 106 Prophage TA293343 1634656..1668117 0 View NZ_LT615378 Escherichia coli isolate 103 Prophage TA293374 1634656..1661524 0.007 View NZ_LT615378 Escherichia coli isolate 103 Prophage TA293374 1634656..1668117 0 View NC_010473 Escherichia coli str. K-12 substr. DH10B Prophage TA022686 1718651..1753448 0 View NC_012759 Escherichia coli BW2952 Prophage TA023854 1521085..1554546 0 View NZ_CP009273 Escherichia coli BW25113 Prophage TA048683 1625259..1658720 0 View NZ_HG738867 Escherichia coli str. K-12 substr. MC4100 strain K-12 Prophage TA285017 1519531..1552992 0	inside	Prophage	-	-	1631002..1664463	33461

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (5-86)

Antitoxin

• RelB antitoxin/Antitoxin DinJ (1-79)

Sequences

Toxin

Protein

• Length: 96 a.a.
• Molecular weight: 11225.22 Da
• Isoelectric Point: 10.1967

>T1041 NP_416081.1 NC_000913:c1645633-1645346 [Escherichia coli str. K-12 substr. MG1655]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL

Nucleotide

• Length: 288 bp

>T1041 NC_000913:c1645633-1645346 [Escherichia coli str. K-12 substr. MG1655]
ATGGCGTATTTTCTGGATTTTGACGAGCGGGCACTAAAGGAATGGCGAAAGCTGGGCTCGACGGTACGTGAACAGTTGAA
AAAGAAGCTGGTTGAAGTACTTGAGTCACCCCGGATTGAAGCAAACAAGCTCCGTGGTATGCCTGATTGTTACAAGATTA
AGCTCCGGTCTTCAGGCTATCGCCTTGTATACCAGGTTATAGACGAGAAAGTTGTCGTTTTCGTGATTTCTGTTGGGAAA
AGAGAACGCTCGGAAGTATATAGCGAGGCGGTCAAACGCATTCTCTGA

Antitoxin

Protein

• Length: 80 a.a.
• Molecular weight: 9071.48 Da
• Isoelectric Point: 4.5230

>AT1041 NP_416082.1 NC_000913:c1645872-1645633 [Escherichia coli str. K-12 substr. MG1655]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL

Nucleotide

• Length: 240 bp

>AT1041 NC_000913:c1645872-1645633 [Escherichia coli str. K-12 substr. MG1655]
ATGGGTAGCATTAACCTGCGTATTGACGATGAACTTAAAGCGCGTTCTTACGCCGCGCTTGAAAAAATGGGTGTAACTCC
TTCTGAAGCGCTTCGTCTCATGCTCGAGTATATCGCTGACAATGAACGCTTGCCGTTCAAACAGACACTCCTGAGTGATG
AAGATGCTGAACTTGTGGAGATAGTGAAAGAACGGCTTCGTAATCCTAAGCCAGTACGTGTGACGCTGGATGAACTCTGA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T10166	Xenorhabdus nematophila ATCC 19061	58.065	98.936	0.574
T173	Vibrio cholerae O1 biovar El Tor str. N16961	56.383	98.947	0.558
T6132	Escherichia coli	54.255	98.947	0.537
T6131	Escherichia coli	54.255	98.947	0.537
T175	Vibrio cholerae O1 biovar El Tor str. N16961	51.064	98.947	0.505
T6130	Erwinia pyrifoliae Ep1/96	50	98.947	0.495
T6023	Xenorhabdus nematophila ATCC 19061	47.059	89.474	0.421
T10157	Streptococcus suis SC84	33.684	100	0.36

Showing 1 to 8 of 8 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
AT6023	Xenorhabdus nematophila ATCC 19061	41.667	100	0.443
AT6097	Sinorhizobium meliloti 1021	34.667	94.937	0.329

Showing 1 to 2 of 2 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Structures

Toxin

Loading, please wait

• PDB: 4FXI
• PDB: 4FXH
• PDB: 4V7K
• PDB: 2KC9
• PDB: 4FXE
• PDB: 2KC8
• PDB: 4V7J

Antitoxin

Loading, please wait

• PDB: 4FXE
• PDB: 2KC8
• PDB: 2K29
• AlphaFold DB: P0C079

References

(1) Tiffany M Halvorsen et al. (2022) Comparison of Kill Switch Toxins in Plant-Beneficial Pseudomonas fluorescens Reveals Drivers of Lethality, Stability, and Escape. ACS Synthetic Biology 11(11):3785-3796. [PubMed:36346907]

(2) Cyrielle I Kint et al. (2012) The Escherichia coli GTPase ObgE modulates hydroxyl radical levels in response to DNA replication fork arrest. The FEBS Journal 279(19):3692-3704. [PubMed:22863262]

(3) Cajetan Neubauer et al. (2009) The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE. Cell 139(6):1084-95. [PubMed:20005802]

(4) Vivek Anantharaman et al. (2003) New connections in the prokaryotic toxin-antitoxin network: relationship with the eukaryotic nonsense-mediated RNA decay system. Genome Biology 4(12):R81. [PubMed:14659018]


 experimental literature
 in silico analysis literature
 protein structure literature