Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1649000..1649526 | Replicon | chromosome |
Accession | NZ_LT615377 | ||
Organism | Escherichia coli isolate 106 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | BV315_RS08865 | Protein ID | WP_000323025.1 |
Coordinates | 1649000..1649287 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | BV315_RS08870 | Protein ID | WP_000534858.1 |
Coordinates | 1649287..1649526 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BV315_RS08825 | 1644024..1644239 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
BV315_RS25565 | 1644459..1644629 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
BV315_RS08830 | 1644993..1645208 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
BV315_RS08835 | 1645509..1645721 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
BV315_RS25120 | 1645776..1645865 | + | 90 | WP_120795389.1 | hypothetical protein | - |
BV315_RS08840 | 1646143..1646895 | - | 753 | WP_001047135.1 | antitermination protein | - |
BV315_RS08845 | 1646909..1647958 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
BV315_RS08850 | 1647960..1648238 | - | 279 | WP_012304870.1 | hypothetical protein | - |
BV315_RS08855 | 1648305..1648556 | - | 252 | WP_000980994.1 | hypothetical protein | - |
BV315_RS08860 | 1648773..1648928 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
BV315_RS08865 | 1649000..1649287 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
BV315_RS08870 | 1649287..1649526 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
BV315_RS08875 | 1649551..1649856 | + | 306 | WP_001326990.1 | hypothetical protein | - |
BV315_RS08885 | 1650059..1650391 | + | 333 | WP_001301033.1 | protein FlxA | - |
BV315_RS08890 | 1650828..1650977 | - | 150 | WP_011443592.1 | hypothetical protein | - |
BV315_RS08895 | 1651012..1651290 | - | 279 | Protein_1589 | hypothetical protein | - |
BV315_RS08900 | 1651274..1651504 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
BV315_RS08905 | 1651588..1651995 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
BV315_RS08910 | 1652162..1652317 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
BV315_RS08920 | 1652477..1652695 | + | 219 | WP_001171942.1 | hypothetical protein | - |
BV315_RS08930 | 1653263..1653451 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
BV315_RS08935 | 1653448..1653639 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
BV315_RS08940 | 1653732..1654499 | + | 768 | Protein_1596 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1634656..1668117 | 33461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T293343 WP_000323025.1 NZ_LT615377:c1649287-1649000 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|