Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1732995..1733521 | Replicon | chromosome |
Accession | NZ_CP110018 | ||
Organism | Escherichia coli strain DH10B |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | OLR78_RS08615 | Protein ID | WP_000323025.1 |
Coordinates | 1732995..1733282 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | OLR78_RS08620 | Protein ID | WP_000534858.1 |
Coordinates | 1733282..1733521 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR78_RS08565 (1728019) | 1728019..1728234 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
OLR78_RS08570 (1728454) | 1728454..1728624 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
OLR78_RS08575 (1728988) | 1728988..1729203 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
OLR78_RS08580 (1729504) | 1729504..1729716 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
OLR78_RS08585 (1729771) | 1729771..1729860 | + | 90 | WP_120795389.1 | hypothetical protein | - |
OLR78_RS08590 (1730138) | 1730138..1730890 | - | 753 | WP_001047135.1 | antitermination protein | - |
OLR78_RS08595 (1730904) | 1730904..1731953 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
OLR78_RS08600 (1731955) | 1731955..1732233 | - | 279 | WP_012304870.1 | hypothetical protein | - |
OLR78_RS08605 (1732300) | 1732300..1732551 | - | 252 | WP_000980994.1 | protein Rem | - |
OLR78_RS08610 (1732768) | 1732768..1732923 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
OLR78_RS08615 (1732995) | 1732995..1733282 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
OLR78_RS08620 (1733282) | 1733282..1733521 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
OLR78_RS08625 (1733546) | 1733546..1733851 | + | 306 | WP_001326990.1 | protein YdfV | - |
OLR78_RS08630 (1734054) | 1734054..1734386 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
OLR78_RS08635 (1734823) | 1734823..1734972 | - | 150 | WP_011443592.1 | protein YdfW | - |
OLR78_RS08640 (1735007) | 1735007..1735285 | - | 279 | Protein_1690 | protein YdfX | - |
OLR78_RS08645 (1735269) | 1735269..1735499 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
OLR78_RS08650 (1735583) | 1735583..1735990 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
OLR78_RS08655 (1736157) | 1736157..1736312 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
OLR78_RS08660 (1736314) | 1736314..1736442 | + | 129 | WP_000344964.1 | protein YdfB | - |
OLR78_RS08665 (1736472) | 1736472..1736690 | + | 219 | WP_001171942.1 | protein YdfC | - |
OLR78_RS08670 (1737258) | 1737258..1737446 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
OLR78_RS08675 (1737443) | 1737443..1737634 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
OLR78_RS08680 (1737727) | 1737727..1738494 | + | 768 | Protein_1698 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1718651..1753448 | 34797 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T262745 WP_000323025.1 NZ_CP110018:c1733282-1732995 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|