Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1732983..1733509 | Replicon | chromosome |
| Accession | NZ_CP110014 | ||
| Organism | Escherichia coli strain HE_100-10 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | OLR77_RS08620 | Protein ID | WP_000323025.1 |
| Coordinates | 1732983..1733270 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | OLR77_RS08625 | Protein ID | WP_000534858.1 |
| Coordinates | 1733270..1733509 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR77_RS08570 (1728007) | 1728007..1728222 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| OLR77_RS08575 (1728442) | 1728442..1728612 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| OLR77_RS08580 (1728976) | 1728976..1729191 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| OLR77_RS08585 (1729492) | 1729492..1729704 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| OLR77_RS08590 (1729759) | 1729759..1729848 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| OLR77_RS08595 (1730126) | 1730126..1730878 | - | 753 | WP_001047135.1 | antitermination protein | - |
| OLR77_RS08600 (1730892) | 1730892..1731941 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| OLR77_RS08605 (1731943) | 1731943..1732221 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| OLR77_RS08610 (1732288) | 1732288..1732539 | - | 252 | WP_000980994.1 | protein Rem | - |
| OLR77_RS08615 (1732756) | 1732756..1732911 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| OLR77_RS08620 (1732983) | 1732983..1733270 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| OLR77_RS08625 (1733270) | 1733270..1733509 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| OLR77_RS08630 (1733534) | 1733534..1733839 | + | 306 | WP_001326990.1 | protein YdfV | - |
| OLR77_RS08635 (1734042) | 1734042..1734374 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| OLR77_RS08640 (1734811) | 1734811..1734960 | - | 150 | WP_011443592.1 | protein YdfW | - |
| OLR77_RS08645 (1734995) | 1734995..1735273 | - | 279 | Protein_1691 | protein YdfX | - |
| OLR77_RS08650 (1735257) | 1735257..1735487 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| OLR77_RS08655 (1735571) | 1735571..1735978 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
| OLR77_RS08660 (1736145) | 1736145..1736300 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
| OLR77_RS08665 (1736302) | 1736302..1736430 | + | 129 | WP_000344964.1 | protein YdfB | - |
| OLR77_RS08670 (1736460) | 1736460..1736678 | + | 219 | WP_001171942.1 | protein YdfC | - |
| OLR77_RS08675 (1737246) | 1737246..1737434 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
| OLR77_RS08680 (1737431) | 1737431..1737622 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
| OLR77_RS08685 (1737715) | 1737715..1738482 | + | 768 | Protein_1699 | exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1718639..1753436 | 34797 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T262641 WP_000323025.1 NZ_CP110014:c1733270-1732983 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|