Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1594243..1594769 | Replicon | chromosome |
| Accession | NZ_LM995446 | ||
| Organism | Escherichia coli strain K-12 substr. RV308 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | ECRV308_RS07955 | Protein ID | WP_000323025.1 |
| Coordinates | 1594243..1594530 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | ECRV308_RS07960 | Protein ID | WP_000534858.1 |
| Coordinates | 1594530..1594769 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECRV308_RS07915 | 1589267..1589482 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| ECRV308_RS07920 | 1590236..1590451 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| ECRV308_RS07925 | 1590752..1590964 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| ECRV308_RS25340 | 1591019..1591108 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| ECRV308_RS07930 | 1591386..1592138 | - | 753 | WP_001047135.1 | antitermination protein | - |
| ECRV308_RS07935 | 1592152..1593201 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| ECRV308_RS07940 | 1593203..1593481 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| ECRV308_RS07945 | 1593548..1593799 | - | 252 | WP_000980994.1 | hypothetical protein | - |
| ECRV308_RS07950 | 1594016..1594171 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| ECRV308_RS07955 | 1594243..1594530 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| ECRV308_RS07960 | 1594530..1594769 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| ECRV308_RS23530 | 1594794..1595099 | + | 306 | WP_001326990.1 | hypothetical protein | - |
| ECRV308_RS07965 | 1595302..1595634 | + | 333 | WP_001301033.1 | protein FlxA | - |
| ECRV308_RS22835 | 1596071..1596220 | - | 150 | WP_011443592.1 | hypothetical protein | - |
| ECRV308_RS07970 | 1596255..1596533 | - | 279 | Protein_1521 | hypothetical protein | - |
| ECRV308_RS07975 | 1596517..1596747 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| ECRV308_RS07980 | 1596831..1597238 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
| ECRV308_RS07985 | 1597405..1597560 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
| ECRV308_RS07990 | 1597720..1597938 | + | 219 | WP_001171942.1 | hypothetical protein | - |
| ECRV308_RS08000 | 1598506..1598694 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
| ECRV308_RS08005 | 1598691..1598882 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
| ECRV308_RS23545 | 1598975..1599742 | + | 768 | Protein_1528 | exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1579899..1613360 | 33461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T285435 WP_000323025.1 NZ_LM995446:c1594530-1594243 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|