Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1732986..1733512 | Replicon | chromosome |
| Accession | NZ_CP110015 | ||
| Organism | Escherichia coli strain HE_150 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | OLR73_RS08610 | Protein ID | WP_000323025.1 |
| Coordinates | 1732986..1733273 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | OLR73_RS08615 | Protein ID | WP_000534858.1 |
| Coordinates | 1733273..1733512 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR73_RS08560 (1728010) | 1728010..1728225 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| OLR73_RS08565 (1728445) | 1728445..1728615 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| OLR73_RS08570 (1728979) | 1728979..1729194 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| OLR73_RS08575 (1729495) | 1729495..1729707 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| OLR73_RS08580 (1729762) | 1729762..1729851 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| OLR73_RS08585 (1730129) | 1730129..1730881 | - | 753 | WP_001047135.1 | antitermination protein | - |
| OLR73_RS08590 (1730895) | 1730895..1731944 | - | 1050 | WP_283012269.1 | DUF968 domain-containing protein | - |
| OLR73_RS08595 (1731946) | 1731946..1732224 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| OLR73_RS08600 (1732291) | 1732291..1732542 | - | 252 | WP_000980994.1 | protein Rem | - |
| OLR73_RS08605 (1732759) | 1732759..1732914 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| OLR73_RS08610 (1732986) | 1732986..1733273 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| OLR73_RS08615 (1733273) | 1733273..1733512 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| OLR73_RS08620 (1733537) | 1733537..1733842 | + | 306 | WP_001326990.1 | protein YdfV | - |
| OLR73_RS08625 (1734045) | 1734045..1734377 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| OLR73_RS08630 (1734814) | 1734814..1734963 | - | 150 | WP_011443592.1 | protein YdfW | - |
| OLR73_RS08635 (1734998) | 1734998..1735276 | - | 279 | Protein_1689 | protein YdfX | - |
| OLR73_RS08640 (1735260) | 1735260..1735490 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| OLR73_RS08645 (1735574) | 1735574..1735981 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
| OLR73_RS08650 (1736148) | 1736148..1736303 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
| OLR73_RS08655 (1736305) | 1736305..1736433 | + | 129 | WP_000344964.1 | protein YdfB | - |
| OLR73_RS08660 (1736463) | 1736463..1736681 | + | 219 | WP_001171942.1 | protein YdfC | - |
| OLR73_RS08665 (1737249) | 1737249..1737437 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
| OLR73_RS08670 (1737434) | 1737434..1737625 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
| OLR73_RS08675 (1737718) | 1737718..1738485 | + | 768 | Protein_1697 | exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1718642..1753439 | 34797 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T262667 WP_000323025.1 NZ_CP110015:c1733273-1732986 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|